Diaphorina citri psyllid: psy7101


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MKLLSPLELVEQSEGEDSAEEESTEGNAYHREKLRQYQLNRLKYYYAVVVFDSAESANKVYTECDGMEYESSATRVDLRFVPDDTEFDEHFDPGKWPLSSSSNISPQADLMVHLPQIRDDHMKYISELAR
cccccccHHcccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHcccccHHccccEEEEEECccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHc
****SPL************************EKLRQYQLNRLKYYYAVVVFDSAESANKVYTECDGMEYESSATRVDLRFVPDDTEFDEHFD*********SNISPQADLMVHLPQIRDDHMKYISELA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLLSPLELVEQSEGEDSAEEESTEGNAYHREKLRQYQLNRLKYYYAVVVFDSAESANKVYTECDGMEYESSATRVDLRFVPDDTEFDEHFDPGKWPLSSSSNISPQADLMVHLPQIRDDHMKYISELAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-rRNA-processing protein ESF1 Involved in the 18S rRNA synthesis. Required for the early cleavages at sites A0, A1 and A2.confidentQ06344
ESF1 homolog May constitute a novel regulatory system for basal transcription. Negatively regulates ABT1.confidentQ3V1V3
Pre-rRNA-processing protein esf1 Involved in the 18S rRNA synthesis. Required for the early cleavages at sites A0, A1 and A2.confidentO74828

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031209 [CC]SCAR complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0044085 [BP]cellular component biogenesisprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8C, chain A
Confidence level:very confident
Coverage over the Query: 53-130
View the alignment between query and template
View the model in PyMOL
Template: 2L9W, chain A
Confidence level:probable
Coverage over the Query: 28-71
View the alignment between query and template
View the model in PyMOL