Diaphorina citri psyllid: psy7103

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MNIVRKLRSGSTGGVAPSSHEDSSQHSALGVMHLKKLFAEFSHSVNHLSEKEKDDKLYNMLPLFCKVFGNSNSADMTDKFRDVHQFCDHVSRLMVTKVCQRASNQSTEIASCAIAKFLEIENSEESSSGWMLLSTLNLLAAGDVSLVEVMTKASLPSTLVKCLYLFFDLPQMNEEEANITDVNSDFTPRERRILLQKIFVQLLVRLCSHSAPAEELSNKDDLTLLFSAITSLCPPYNVIWRKSAAEILMSLSSQALTPKVVQYVHDKGCIALCIENMTRRKGQDLTPLEIVEMFVSVFCFLKDSSEVSQILLKDFKEAHGYTFLKNFLINLENDRSSEAQEAIRNLILMIATLSMCGYVELRPNAASMGCIFQILGFCMPQPSGRGKFKLRSLDGRKKNDSELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNGATN
ccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccc
*****************************GVMHLKKLFAEFSHSVNH*******DKLYNMLPLFCKVFGNSNSADMTDKFRDVHQFCDHVSRLMVTKVCQRASNQSTEIASCAIAKFLEIENSEESSSGWMLLSTLNLLAAGDVSLVEVMTKASLPSTLVKCLYLFFDLPQMNE*********SDFTPRERRILLQKIFVQLLVRLCSHSAPAEELSNKDDLTLLFSAITSLCPPYNVIWRKSAAEILMSLSSQALTPKVVQYVHDKGCIALCIENMTRRKGQDLTPLEIVEMFVSVFCFLKDSSEVSQILLKDFKEAHGYTFLKNFLINLEND****AQEAIRNLILMIATLSMCGYVELRPNAASMGCIFQILGFCMPQP*******LRSLDGRKKNDSELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIVRKLRSGSTGGVAPSSHEDSSQHSALGVMHLKKLFAEFSHSVNHLSEKEKDDKLYNMLPLFCKVFGNSNSADMTDKFRDVHQFCDHVSRLMVTKVCQRASNQSTEIASCAIAKFLEIENSEESSSGWMLLSTLNLLAAGDVSLVEVMTKASLPSTLVKCLYLFFDLPQMNEEEANITDVNSDFTPRERRILLQKIFVQLLVRLCSHSAPAEELSNKDDLTLLFSAITSLCPPYNVIWRKSAAEILMSLSSQALTPKVVQYVHDKGCIALCIENMTRRKGQDLTPLEIVEMFVSVFCFLKDSSEVSQILLKDFKEAHGYTFLKNFLINLENDRSSEAQEAIRNLILMIATLSMCGYVELRPNAASMGCIFQILGFCMPQPSGRGKFKLRSLDGRKKNDSELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNGATN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat and FYVE domain-containing protein 3 confidentQ6VNB8
WD repeat and FYVE domain-containing protein 3 confidentQ8IZQ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0005776 [CC]autophagic vacuoleprobableGO:0005737, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0019898 [CC]extrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0005545 [MF]1-phosphatidylinositol bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003831 [MF]beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0048786 [CC]presynaptic active zoneprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8C, chain A
Confidence level:very confident
Coverage over the Query: 400-467
View the alignment between query and template
View the model in PyMOL
Template: 3TPO, chain A
Confidence level:probable
Coverage over the Query: 54-174,193-326
View the alignment between query and template
View the model in PyMOL
Template: 4HXT, chain A
Confidence level:probable
Coverage over the Query: 130-174,193-360
View the alignment between query and template
View the model in PyMOL