Diaphorina citri psyllid: psy7112

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MDAQQFLLMRLESGNLSNIKNALKTFIEANSDSFTFPTLDRDKLDKLYSLVFNILCNPMYSECYIDCLSCLKLLFRDSKYLDELISQERFNILLQTARLYNTQPTPSSLEQLGSGAGEGESHNADALLTIITYLHEELASRVPSPGTTPTSSSGTVDHILPVLHVLSEAARHHKALRRLIRNQILPARRDFSSRPEEGDSLLSHLTRCLSSGNTMLRDCCADLLFVLCKENPARLIKYTGYGNAAGMLAARGLLGCQNKGQYSSSSEESDTEEYLRVKDNINPVTGVYEPPKPDSTQEHLRSTFETVSLTSAYSETVQA
ccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHc
***QQFLLMRLESGNLSNIKNALKTFIEANSDSFTFPTLDRDKLDKLYSLVFNILCNPMYSECYIDCLSCLKLLFRDSKYLDELISQERFNILLQTARLYNTQPTPSSL****SG*GEGESHNADALLTIITYLHEELASRVPS******SSSGTVDHILPVLHVLSEAARHHKALRRLIRNQILPARR**********SLLSHLTRCLSSGNTMLRDCCADLLFVLCKENPARLIKYTGYGNAAGMLAARGLLG****************************VT*********************VSLTSAYSETV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAQQFLLMRLESGNLSNIKNALKTFIEANSDSFTFPTLDRDKLDKLYSLVFNILCNPMYSECYIDCLSCLKLLFRDSKYLDELISQERFNILLQTARLYNTQPTPSSLEQLGSGAGEGESHNADALLTIITYLHEELASRVPSPGTTPTSSSGTVDHILPVLHVLSEAARHHKALRRLIRNQILPARRDFSSRPEEGDSLLSHLTRCLSSGNTMLRDCCADLLFVLCKENPARLIKYTGYGNAAGMLAARGLLGCQNKGQYSSSSEESDTEEYLRVKDNINPVTGVYEPPKPDSTQEHLRSTFETVSLTSAYSETVQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Synembryn-A Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein.confidentQ6P4W7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!