Diaphorina citri psyllid: psy7115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MFLKINEAWNILKDEKERKLYESQLLSQQQTHMNIYKSVSLSDMEHKGESQMFTYPCRCGAEFCIEEQDTEGDGSDDNILIACDTCSLLLEITARCGAEFCIEEQDTKGDSSEGNILIACDTCSLLLEITAR
cHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccCEEEEEccccccccccCEEEEEccccccEEEEccccccccccccEEEEcccccEEEEEEEEccccEEEEccccccccccCEEEEEcccccEEEEEEEc
MFLKINEAWNILKDEKERKLYESQLLSQQQTHMNIYKSVSLSDMEHKGESQMFTYPCRCGAEFCIEEQDTEGDGSDDNILIACDTCSLLLEITARCGAEFCIEEQ*******EGNILIACDTCSLLLEIT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLKINEAWNILKDEKERKLYESQLLSQQQTHMNIYKSVSLSDMEHKGESQMFTYPCRCGAEFCIEEQDTEGDGSDDNILIACDTCSLLLEITARCGAEFCIEEQDTKGDSSEGNILIACDTCSLLLEITAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily C member 24 Stimulates the ATPase activity of several Hsp70-type chaperones.confidentQ0VBY7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L6L, chain A
Confidence level:very confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL
Template: 2JR7, chain A
Confidence level:confident
Coverage over the Query: 65-130
View the alignment between query and template
View the model in PyMOL