Diaphorina citri psyllid: psy7132


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MGLIGGALFHGIKGFRNAPSGMNRRFLGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGAFYLNG
cccccHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc
MGLIGGALFHGIKGFRNAPSGMNRRFLGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGAFYLNG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLIGGALFHGIKGFRNAPSGMNRRFLGMTTTIKQKSPILAGNFAVWGAMFSTIDCSLVYVRKKEDPWNSIISGAATGGILAARNGVPAMAGSALIGAFYLNG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit tim17 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.confidentP87130
Mitochondrial import inner membrane translocase subunit TIM17-2 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.confidentQ9SP35
Mitochondrial import inner membrane translocase subunit TIM17 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.confidentP39515

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000002 [BP]mitochondrial genome maintenanceprobableGO:0006996, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0007005, GO:0008150, GO:0044699
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005744 [CC]mitochondrial inner membrane presequence translocase complexprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0030150 [BP]protein import into mitochondrial matrixprobableGO:0008104, GO:0051649, GO:0071840, GO:0044699, GO:0071806, GO:0070727, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0007005, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0072594, GO:0006626, GO:0006810, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0072655, GO:0006839, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0044763, GO:0009987
GO:0031305 [CC]integral to mitochondrial inner membraneprobableGO:0044464, GO:0031975, GO:0031304, GO:0043229, GO:0031301, GO:0031300, GO:0032592, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0015266 [MF]protein channel activityprobableGO:0008565, GO:0022891, GO:0022892, GO:0022884, GO:0005215, GO:0008320, GO:0022857, GO:0015267, GO:0003674, GO:0022803
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted