Diaphorina citri psyllid: psy7151


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
ccccccccccEEECcccccccCCccccccccccccEEEEEcccccHHHHccccCEEEccccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHccccccccEEEEEEEcccccHHHHHHHHcccEEEEEcHHHHHHHHc
*E*LKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GMP synthase [glutamine-hydrolyzing] confidentQ4V7C6
GMP synthase [glutamine-hydrolyzing] Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.confidentQ3THK7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003921 [MF]GMP synthase activityprobableGO:0016879, GO:0003674, GO:0016874, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0072522 [BP]purine-containing compound biosynthetic processprobableGO:1901576, GO:0044271, GO:1901566, GO:0071704, GO:0009987, GO:0006725, GO:0009058, GO:0044237, GO:1901564, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0019438, GO:0072521, GO:0046483, GO:1901362, GO:1901360, GO:0018130
GO:0009168 [BP]purine ribonucleoside monophosphate biosynthetic processprobableGO:0009167, GO:0034641, GO:0006807, GO:0044281, GO:0009161, GO:0009123, GO:1901362, GO:0009127, GO:0009124, GO:0006139, GO:0044710, GO:0009126, GO:0071704, GO:1901360, GO:0018130, GO:1901576, GO:0009156, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0034654, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:0044249, GO:0044237, GO:0006796, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VXO, chain A
Confidence level:very confident
Coverage over the Query: 4-67,116,128-184
View the alignment between query and template
View the model in PyMOL
Template: 1GPM, chain A
Confidence level:very confident
Coverage over the Query: 37-158
View the alignment between query and template
View the model in PyMOL