Psyllid ID: psy7151


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
ccccccccccEEEEcccccccEEccccccccccccEEEEEcccccHHHHccccEEEEccccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHccccccccEEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHc
ccHHcccccHHHEccccccccccccccHHccccccEEEEEccccccccccccccEEEEEHHHHccHHHcEEEEEccccEEccHcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccHccccHHHHHHHHHHcEEEEcHHHHHHHHc
meelkldpnqtllcqgtlrpdliESASHLASNKADvikthhndsPLIRALREqgkvieplkdfhkdelrlyglqfhpevdltnegRTMLKNFLFDVcgltgnftLKSREEELIKYVKETVGNMKVLVRKLgldlgltpevvmrhpfpgpglAIRVICGeeryiekdysETQVLVKIIVEYDQMFKKII
meelkldpnqtllCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPevvmrhpfpgpgLAIRVICGEERYiekdysetqvLVKIIVEYDQMFKKII
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
************LCQGTL******************I*******PLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFK***
*E*LKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
****KLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIVEYDQMFKKII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query188 2.2.26 [Sep-21-2011]
Q3THK7 693 GMP synthase [glutamine-h yes N/A 0.414 0.112 0.658 6e-23
Q5RA96 693 GMP synthase [glutamine-h yes N/A 0.329 0.089 0.714 7e-23
Q4V7C6 693 GMP synthase [glutamine-h yes N/A 0.414 0.112 0.658 7e-23
P49915 693 GMP synthase [glutamine-h yes N/A 0.329 0.089 0.714 8e-23
Q09580 745 Probable GMP synthase [gl yes N/A 0.377 0.095 0.652 2e-20
P32073 718 GMP synthase [glutamine-h yes N/A 0.361 0.094 0.611 1e-19
C3KUC5 510 GMP synthase [glutamine-h yes N/A 0.452 0.166 0.453 8e-14
A7GIN0 510 GMP synthase [glutamine-h yes N/A 0.452 0.166 0.430 7e-13
B1IFD1 510 GMP synthase [glutamine-h yes N/A 0.452 0.166 0.430 7e-13
B1L1J7 510 GMP synthase [glutamine-h yes N/A 0.329 0.121 0.5 7e-13
>sp|Q3THK7|GUAA_MOUSE GMP synthase [glutamine-hydrolyzing] OS=Mus musculus GN=Gmps PE=1 SV=2 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 64/82 (78%), Gaps = 4/82 (4%)

Query: 3   ELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKD 62
           E+ L P +  L QGTLRPDLIESAS +AS KA++IKTHHND+ LIR LRE+GKVIEPLKD
Sbjct: 354 EMSLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKD 413

Query: 63  FHKDELRLYGLQFHPEVDLTNE 84
           FHKDE+R+ G     E+DL  E
Sbjct: 414 FHKDEVRILGR----ELDLPEE 431




Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 5EC: .EC: 2
>sp|Q5RA96|GUAA_PONAB GMP synthase [glutamine-hydrolyzing] OS=Pongo abelii GN=GMPS PE=2 SV=1 Back     alignment and function description
>sp|Q4V7C6|GUAA_RAT GMP synthase [glutamine-hydrolyzing] OS=Rattus norvegicus GN=Gmps PE=1 SV=1 Back     alignment and function description
>sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens GN=GMPS PE=1 SV=1 Back     alignment and function description
>sp|Q09580|GUAA_CAEEL Probable GMP synthase [glutamine-hydrolyzing] OS=Caenorhabditis elegans GN=M106.4 PE=2 SV=3 Back     alignment and function description
>sp|P32073|GUAA_DICDI GMP synthase [glutamine-hydrolyzing] OS=Dictyostelium discoideum GN=guaA PE=1 SV=2 Back     alignment and function description
>sp|C3KUC5|GUAA_CLOB6 GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain 657 / Type Ba4) GN=guaA PE=3 SV=1 Back     alignment and function description
>sp|A7GIN0|GUAA_CLOBL GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=guaA PE=3 SV=1 Back     alignment and function description
>sp|B1IFD1|GUAA_CLOBK GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Okra / Type B1) GN=guaA PE=3 SV=1 Back     alignment and function description
>sp|B1L1J7|GUAA_CLOBM GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=guaA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
270012865 687 hypothetical protein TcasGA2_TC030725 [T 0.664 0.181 0.473 3e-34
189240082 748 PREDICTED: similar to gmp synthase [Trib 0.664 0.167 0.473 3e-34
195388470 684 GJ19601 [Drosophila virilis] gi|19414936 0.675 0.185 0.451 3e-32
344237456 1159 GMP synthase [glutamine-hydrolyzing] [Cr 0.664 0.107 0.451 1e-31
242013853 685 GMP synthase, putative [Pediculus humanu 0.675 0.185 0.462 2e-30
380022489 716 PREDICTED: GMP synthase [glutamine-hydro 0.675 0.177 0.435 4e-30
380022491 718 PREDICTED: GMP synthase [glutamine-hydro 0.675 0.176 0.435 4e-30
66522082 718 PREDICTED: GMP synthase [glutamine-hydro 0.675 0.176 0.435 4e-30
345480532 718 PREDICTED: GMP synthase [glutamine-hydro 0.675 0.176 0.446 5e-30
307213208 718 GMP synthase [glutamine-hydrolyzing] [Ha 0.675 0.176 0.440 5e-30
>gi|270012865|gb|EFA09313.1| hypothetical protein TcasGA2_TC030725 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 105/188 (55%), Gaps = 63/188 (33%)

Query: 1   MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
           + +L L P + +L QGTLRPDLIESAS L S+KAD IKTHHNDS L+R LR         
Sbjct: 346 ISDLNLKPEEVVLAQGTLRPDLIESASALVSSKADTIKTHHNDSELVRKLR--------- 396

Query: 61  KDFHKDELRLYGLQFHPEVDLTNEGRTM--LKNFLFDVCGLTGNFTLKSREEELIKYVKE 118
                                 +EGR +  LK+F  D                       
Sbjct: 397 ----------------------SEGRVVEPLKDFHKDE---------------------- 412

Query: 119 TVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIV 178
                   VR LG DLGLTPE+VMRHPFPGPGLAIRV+C EE Y+E+D+SETQVLVKIIV
Sbjct: 413 --------VRALGRDLGLTPELVMRHPFPGPGLAIRVLCAEEPYMERDFSETQVLVKIIV 464

Query: 179 EYDQMFKK 186
           E+DQM +K
Sbjct: 465 EFDQMLQK 472




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189240082|ref|XP_001812886.1| PREDICTED: similar to gmp synthase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195388470|ref|XP_002052903.1| GJ19601 [Drosophila virilis] gi|194149360|gb|EDW65058.1| GJ19601 [Drosophila virilis] Back     alignment and taxonomy information
>gi|344237456|gb|EGV93559.1| GMP synthase [glutamine-hydrolyzing] [Cricetulus griseus] Back     alignment and taxonomy information
>gi|242013853|ref|XP_002427615.1| GMP synthase, putative [Pediculus humanus corporis] gi|212512030|gb|EEB14877.1| GMP synthase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380022489|ref|XP_003695076.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|380022491|ref|XP_003695077.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|66522082|ref|XP_393336.2| PREDICTED: GMP synthase [glutamine-hydrolyzing] [Apis mellifera] Back     alignment and taxonomy information
>gi|345480532|ref|XP_003424167.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307213208|gb|EFN88703.1| GMP synthase [glutamine-hydrolyzing] [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
ZFIN|ZDB-GENE-040426-1503 692 gmps "guanine monphosphate syn 0.404 0.109 0.701 6.7e-40
FB|FBgn0000239 720 bur "burgundy" [Drosophila mel 0.372 0.097 0.657 1.1e-38
MGI|MGI:2448526 693 Gmps "guanine monophosphate sy 0.414 0.112 0.658 4.8e-22
RGD|1310063 693 Gmps "guanine monphosphate syn 0.414 0.112 0.658 4.8e-22
UNIPROTKB|Q4V7C6 693 Gmps "GMP synthase [glutamine- 0.414 0.112 0.658 4.8e-22
UNIPROTKB|F1NAQ8 693 GMPS "Uncharacterized protein" 0.404 0.109 0.688 4.8e-22
UNIPROTKB|F8W720 594 GMPS "GMP synthase [glutamine- 0.404 0.127 0.675 5.5e-22
UNIPROTKB|J9NTM1 674 GMPS "Uncharacterized protein" 0.404 0.112 0.675 7.4e-22
UNIPROTKB|P49915 693 GMPS "GMP synthase [glutamine- 0.404 0.109 0.675 7.8e-22
UNIPROTKB|F1MC86 694 GMPS "Uncharacterized protein" 0.404 0.109 0.675 7.9e-22
ZFIN|ZDB-GENE-040426-1503 gmps "guanine monphosphate synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 6.7e-40, Sum P(2) = 6.7e-40
 Identities = 54/77 (70%), Positives = 61/77 (79%)

Query:     3 ELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKD 62
             E+ L P    L QGTLRPDLIESASHLAS KA+VIKTHHND+ LIR LR++GKVIEPLKD
Sbjct:   353 EMNLKPEDVYLAQGTLRPDLIESASHLASGKAEVIKTHHNDTELIRKLRDEGKVIEPLKD 412

Query:    63 FHKDELRLYGLQFH-PE 78
             FHKDE+R  G +   PE
Sbjct:   413 FHKDEVRALGRELGLPE 429


GO:0003922 "GMP synthase (glutamine-hydrolyzing) activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006177 "GMP biosynthetic process" evidence=IEA
GO:0016462 "pyrophosphatase activity" evidence=IEA
GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
FB|FBgn0000239 bur "burgundy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2448526 Gmps "guanine monophosphate synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310063 Gmps "guanine monphosphate synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V7C6 Gmps "GMP synthase [glutamine-hydrolyzing]" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAQ8 GMPS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F8W720 GMPS "GMP synthase [glutamine-hydrolyzing]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTM1 GMPS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49915 GMPS "GMP synthase [glutamine-hydrolyzing]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MC86 GMPS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4V7C6GUAA_RAT6, ., 3, ., 5, ., 20.65850.41480.1125yesN/A
Q3THK7GUAA_MOUSE6, ., 3, ., 5, ., 20.65850.41480.1125yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.5LOW CONFIDENCE prediction!
3rd Layer6.3.5.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
cd01997295 cd01997, GMP_synthase_C, The C-terminal domain of 2e-21
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 1e-19
PLN02347 536 PLN02347, PLN02347, GMP synthetase 6e-14
PRK00074511 PRK00074, guaA, GMP synthase; Reviewed 8e-14
cd01997295 cd01997, GMP_synthase_C, The C-terminal domain of 6e-13
PRK00074511 PRK00074, guaA, GMP synthase; Reviewed 1e-12
COG0519315 COG0519, GuaA, GMP synthase, PP-ATPase domain/subu 3e-11
TIGR00884311 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hyd 1e-10
COG0519315 COG0519, GuaA, GMP synthase, PP-ATPase domain/subu 2e-10
TIGR00884311 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hyd 4e-10
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 2e-09
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 2e-09
PLN02347536 PLN02347, PLN02347, GMP synthetase 5e-09
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 9e-08
PLN02347536 PLN02347, PLN02347, GMP synthetase 1e-07
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 2e-07
PRK00919307 PRK00919, PRK00919, GMP synthase subunit B; Valida 3e-07
PRK00919307 PRK00919, PRK00919, GMP synthase subunit B; Valida 6e-07
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 1e-06
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 2e-06
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Valida 2e-06
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 7e-06
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 2e-05
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 2e-05
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase co 4e-05
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilat 7e-04
PLN02335222 PLN02335, PLN02335, anthranilate synthase 0.001
>gnl|CDD|238955 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase Back     alignment and domain information
 Score = 88.7 bits (221), Expect = 2e-21
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 1   MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
            ++L L      L QGTL PD+IES S   S  AD IK+HHN   L      + K+IEPL
Sbjct: 95  AKKLGLA---EYLAQGTLYPDVIESGSGKGS--ADTIKSHHNVGGLPE--DMKLKLIEPL 147

Query: 61  KDFHKDELRLYGLQF 75
           +D  KDE+R  G + 
Sbjct: 148 RDLFKDEVRELGREL 162


It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes. Length = 295

>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|238955 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|223593 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233169 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>gnl|CDD|223593 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233169 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|214365 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
PLN02347 536 GMP synthetase 99.94
PRK00074 511 guaA GMP synthase; Reviewed 99.93
KOG1622|consensus 552 99.93
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.86
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.68
KOG0026|consensus223 99.66
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.64
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.58
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.56
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.51
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.48
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.47
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.46
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.42
PRK05637208 anthranilate synthase component II; Provisional 99.41
CHL00101190 trpG anthranilate synthase component 2 99.4
PRK06895190 putative anthranilate synthase component II; Provi 99.39
KOG1224|consensus 767 99.37
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.3
PLN02335222 anthranilate synthase 99.3
KOG1622|consensus552 99.29
PRK05670189 anthranilate synthase component II; Provisional 99.24
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.22
PRK00758184 GMP synthase subunit A; Validated 99.22
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.21
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.21
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 99.2
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.19
COG0519 315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 99.16
PRK13566720 anthranilate synthase; Provisional 99.13
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.13
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.06
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.03
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.01
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.0
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 98.97
PRK12564360 carbamoyl phosphate synthase small subunit; Review 98.86
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 98.85
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 98.83
COG2071243 Predicted glutamine amidotransferases [General fun 98.8
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 98.8
PRK12838354 carbamoyl phosphate synthase small subunit; Review 98.79
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 98.79
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 98.78
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 98.77
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 98.72
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 98.7
PRK00768 268 nadE NAD synthetase; Reviewed 98.61
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 98.6
PTZ00323 294 NAD+ synthase; Provisional 98.57
PF02540 242 NAD_synthase: NAD synthase; InterPro: IPR022310 NA 98.54
COG0171 268 NadE NAD synthase [Coenzyme metabolism] 98.48
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 98.46
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 98.45
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 98.42
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 98.39
PRK00919 307 GMP synthase subunit B; Validated 98.27
PLN02347536 GMP synthetase 98.25
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 98.25
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 98.23
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 98.2
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 98.2
PLN02617 538 imidazole glycerol phosphate synthase hisHF 98.13
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 98.11
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 98.08
cd00553 248 NAD_synthase NAD+ synthase is a homodimer, which c 98.07
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 98.06
PRK13980 265 NAD synthetase; Provisional 98.03
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 97.98
PRK05380533 pyrG CTP synthetase; Validated 97.95
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 97.88
PRK09065237 glutamine amidotransferase; Provisional 97.82
PRK00876 326 nadE NAD synthetase; Reviewed 97.81
PRK06186229 hypothetical protein; Validated 97.8
PRK06490239 glutamine amidotransferase; Provisional 97.78
PRK13981 540 NAD synthetase; Provisional 97.77
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 97.68
PLN02327557 CTP synthase 97.59
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 97.54
PRK05665240 amidotransferase; Provisional 97.51
PRK08250235 glutamine amidotransferase; Provisional 97.47
TIGR00552 250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 97.45
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 97.35
PRK02628 679 nadE NAD synthetase; Reviewed 97.34
PRK07053234 glutamine amidotransferase; Provisional 97.23
PRK07567242 glutamine amidotransferase; Provisional 97.2
TIGR00884311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 97.07
PLN02339 700 NAD+ synthase (glutamine-hydrolysing) 97.03
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 97.02
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 96.85
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthe 96.79
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 96.56
TIGR03573 343 WbuX N-acetyl sugar amidotransferase. This enzyme 95.89
KOG0370|consensus 1435 95.66
KOG1559|consensus340 94.78
TIGR00268 252 conserved hypothetical protein TIGR00268. The N-te 94.78
COG0482 356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid 94.7
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 94.64
PRK00919307 GMP synthase subunit B; Validated 94.54
PF03054 356 tRNA_Me_trans: tRNA methyl transferase; InterPro: 94.23
cd01997 295 GMP_synthase_C The C-terminal domain of GMP synthe 94.04
KOG2805|consensus 377 93.57
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine 93.56
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 93.5
cd01712 177 ThiI ThiI is required for thiazole synthesis in th 93.17
PRK00074511 guaA GMP synthase; Reviewed 93.02
KOG0623|consensus 541 92.72
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 92.46
cd01991 269 Asn_Synthase_B_C The C-terminal domain of Asparagi 91.81
PRK13795 636 hypothetical protein; Provisional 91.2
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 90.96
TIGR00364 201 exsB protein. This protein family is represented b 90.95
PRK10696 258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 90.93
PF00733 255 Asn_synthase: Asparagine synthase; InterPro: IPR00 90.74
TIGR02432 189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 90.71
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 90.53
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 90.19
PRK08349 198 hypothetical protein; Validated 89.17
cd01998 349 tRNA_Me_trans tRNA methyl transferase. This family 89.16
cd01993 185 Alpha_ANH_like_II This is a subfamily of Adenine n 88.97
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 88.97
PRK00143 346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 88.91
TIGR00420 352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 88.77
PF01171 182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 88.57
PRK01565 394 thiamine biosynthesis protein ThiI; Provisional 88.53
cd01992 185 PP-ATPase N-terminal domain of predicted ATPase of 87.93
cd01995 169 ExsB ExsB is a transcription regulator related pro 87.74
PTZ00077 586 asparagine synthetase-like protein; Provisional 87.55
TIGR00342 371 thiazole biosynthesis/tRNA modification protein Th 87.44
cd01990 202 Alpha_ANH_like_I This is a subfamily of Adenine nu 87.4
cd01713 173 PAPS_reductase This domain is found in phosphoaden 86.88
TIGR01536 467 asn_synth_AEB asparagine synthase (glutamine-hydro 86.63
PRK13794 479 hypothetical protein; Provisional 86.59
PRK08384 381 thiamine biosynthesis protein ThiI; Provisional 86.42
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 85.9
PRK11106 231 queuosine biosynthesis protein QueC; Provisional 85.44
PRK09431 554 asnB asparagine synthetase B; Provisional 85.27
PRK14561 194 hypothetical protein; Provisional 85.26
PLN02549 578 asparagine synthase (glutamine-hydrolyzing) 85.26
PRK13820 394 argininosuccinate synthase; Provisional 83.9
PLN00200 404 argininosuccinate synthase; Provisional 83.42
PRK04527 400 argininosuccinate synthase; Provisional 83.3
PRK00509 399 argininosuccinate synthase; Provisional 83.27
PRK08576 438 hypothetical protein; Provisional 82.91
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated ami 81.94
COG1365 255 Predicted ATPase (PP-loop superfamily) [General fu 81.33
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 81.15
>PLN02347 GMP synthetase Back     alignment and domain information
Probab=99.94  E-value=1.9e-27  Score=222.80  Aligned_cols=137  Identities=26%  Similarity=0.391  Sum_probs=111.8

Q ss_pred             eeecCCeEEecCcccCCcceeEEeeeccccccccccc-------------------cceecc-----cccccccccccEE
Q psy7151          16 GTLRPDLIESASHLASNKADVIKTHHNDSPLIRALRE-------------------QGKVIE-----PLKDFHKDELRLY   71 (188)
Q Consensus        16 g~~~g~~I~~~~~~~HGk~~~V~s~H~~~~Lf~~lp~-------------------~s~vi~-----pi~Ai~~~~~~i~   71 (188)
                      +.++|+.|.+.+.+.||.....  .+.+.+||+++|.                   ++.+++     +++|+++.++++|
T Consensus       100 a~alGG~V~~~~~~e~G~~~v~--i~~~~~Lf~~l~~~~~~~v~~~Hsd~V~~lP~g~~vlA~s~~~~iaai~~~~~~i~  177 (536)
T PLN02347        100 VQKLGGEVKPGEKQEYGRMEIR--VVCGSQLFGDLPSGETQTVWMSHGDEAVKLPEGFEVVAKSVQGAVVAIENRERRIY  177 (536)
T ss_pred             HHHcCCEEEecCCcccceEEEE--EcCCChhhhcCCCCceEEEEEEEEEEeeeCCCCCEEEEEeCCCcEEEEEECCCCEE
Confidence            3468999999988889987643  2445556666642                   222222     4789998889999


Q ss_pred             EEeecccccCChhhHHHHHHHHHHhhCCCCCcccchHHHHHHHHHHHHhC-CCcEEEEeeccccCCChhhHhhcCC---C
Q psy7151          72 GLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVG-NMKVLVRKLGLDLGLTPEVVMRHPF---P  147 (188)
Q Consensus        72 GVQFHPE~~~t~~G~~il~nFl~~i~~~~~~W~~~~~ie~iI~~IRe~Vg-~~kVi~~~~GlSGGvDSavva~~~~---p  147 (188)
                      |+|||||+.+|+.|.+||+||+..+|+|+++|+|++++++.++.||++++ +++|++   |+||||||+|+|.++.   .
T Consensus       178 GvQFHPE~~~t~~G~~iL~NFl~~ic~~~~~~~~~~~~~~~i~~i~~~~~~~~~vvv---alSGGVDSsvla~l~~~alG  254 (536)
T PLN02347        178 GLQYHPEVTHSPKGMETLRHFLFDVCGVTADWKMQDVLEEQIELIKATVGPDEHVIC---ALSGGVDSTVAATLVHKAIG  254 (536)
T ss_pred             EEEccCCCCccchHHHHHHHHHHHHhCcCCCcCcchHHHHHHHHHHHHhccCCeEEE---EecCChhHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999 567888   9999999999994443   3


Q ss_pred             CCceEEEEec
Q psy7151         148 GPGLAIRVIC  157 (188)
Q Consensus       148 ~~~L~v~~~~  157 (188)
                      ++.+++-+..
T Consensus       255 ~~v~av~id~  264 (536)
T PLN02347        255 DRLHCVFVDN  264 (536)
T ss_pred             CcEEEEEEeC
Confidence            5677777653



>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0026|consensus Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>KOG1224|consensus Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>PLN02339 NAD+ synthase (glutamine-hydrolysing) Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>KOG1559|consensus Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>KOG2805|consensus Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>KOG0623|consensus Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>TIGR00364 exsB protein Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO) Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PTZ00077 asparagine synthetase-like protein; Provisional Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>PRK14561 hypothetical protein; Provisional Back     alignment and domain information
>PLN02549 asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 5e-24
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 4e-15
2vpi_A218 Human Gmp Synthetase - Glutaminase Domain Length = 2e-09
1gpm_A525 Escherichia Coli Gmp Synthetase Complexed With Amp 7e-09
1gpm_A 525 Escherichia Coli Gmp Synthetase Complexed With Amp 7e-08
1gpm_A525 Escherichia Coli Gmp Synthetase Complexed With Amp 3e-06
3tqi_A 527 Structure Of The Gmp Synthase (Guaa) From Coxiella 4e-08
3uow_A556 Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr 7e-08
3uow_A556 Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr 3e-05
2ywc_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-06
2ywc_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-04
2ywb_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-06
2ywb_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 1e-04
2dpl_A308 Crystal Structure Of The Gmp Synthase From Pyrococc 1e-05
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 4e-04
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 5e-04
>pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure

Iteration: 1

Score = 107 bits (266), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 50/70 (71%), Positives = 59/70 (84%) Query: 3 ELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKD 62 E+ L P + L QGTLRPDLIESAS +AS KA++IKTHHND+ LIR LRE+GKVIEPLKD Sbjct: 358 EMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKD 417 Query: 63 FHKDELRLYG 72 FHKDE+R+ G Sbjct: 418 FHKDEVRILG 427
>pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|3TQI|A Chain A, Structure Of The Gmp Synthase (Guaa) From Coxiella Burnetii Length = 527 Back     alignment and structure
>pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 Back     alignment and structure
>pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 Back     alignment and structure
>pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308 Back     alignment and structure
>pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure
>pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 5e-30
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 2e-26
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 3e-19
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 5e-20
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 2e-13
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 3e-11
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 6e-20
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 2e-13
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 6e-11
3uow_A 556 GMP synthetase; structural genomics consortium, SG 1e-19
3uow_A556 GMP synthetase; structural genomics consortium, SG 1e-13
3uow_A556 GMP synthetase; structural genomics consortium, SG 5e-13
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 9e-18
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 2e-13
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 4e-11
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 5e-16
2a9v_A212 GMP synthase; structural genomics, joint center fo 9e-13
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 1e-12
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 1e-09
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 7e-09
1i1q_B192 Anthranilate synthase component II; tryptophan bio 6e-08
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 2e-07
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
 Score =  114 bits (288), Expect = 5e-30
 Identities = 50/74 (67%), Positives = 61/74 (82%)

Query: 1   MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
           + E+ L P +  L QGTLRPDLIESAS +AS KA++IKTHHND+ LIR LRE+GKVIEPL
Sbjct: 356 IGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPL 415

Query: 61  KDFHKDELRLYGLQ 74
           KDFHKDE+R+ G +
Sbjct: 416 KDFHKDEVRILGRE 429


>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Length = 308 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Length = 308 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.93
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.92
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.92
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.91
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.9
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.52
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.3
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.29
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.14
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.13
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.05
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.05
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 98.93
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 98.84
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 98.81
3q4g_A 279 NH(3)-dependent NAD(+) synthetase; structural geno 98.77
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 98.77
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 98.68
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 98.63
1wxi_A 275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l 98.6
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 98.57
1kqp_A 271 NAD+ synthase, NH(3)-dependent NAD(+) synthetase, 98.47
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 98.46
3dpi_A 285 NAD+ synthetase; ssgcid, decode, structural genomi 98.39
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 98.37
3fiu_A 249 NH(3)-dependent NAD(+) synthetase; rossman fold, a 98.31
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 98.24
3m3p_A250 Glutamine amido transferase; structural genomics, 98.23
3l7n_A236 Putative uncharacterized protein; glutamine amidot 98.13
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 98.11
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 98.09
2dpl_A 308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 98.0
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 97.99
1vco_A550 CTP synthetase; tetramer, riken structural genomic 97.99
2e18_A 257 NH(3)-dependent NAD(+) synthetase; ligase, structu 97.97
3p52_A 249 NH(3)-dependent NAD(+) synthetase; structural geno 97.97
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 97.94
1xng_A 268 NH(3)-dependent NAD(+) synthetase; amidotransferas 97.9
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 97.86
1q7r_A219 Predicted amidotransferase; structural genomics, Y 97.86
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 97.81
3n05_A 590 NH(3)-dependent NAD(+) synthetase; ligase, structu 97.74
4f4h_A 565 Glutamine dependent NAD+ synthetase; structural ge 97.53
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 97.24
3uow_A556 GMP synthetase; structural genomics consortium, SG 96.84
3ilv_A 634 Glutamine-dependent NAD(+) synthetase; protein str 96.8
3sdb_A 680 Glutamine-dependent NAD(+) synthetase; glutamine-a 96.79
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 96.53
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 94.24
1jgt_A 513 Beta-lactam synthetase; asparagine synthetase, cla 92.33
1sur_A 215 PAPS reductase; assimilatory sulfate reduction, 3- 91.65
1q15_A 503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, 91.51
3bl5_A 219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 91.47
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 91.46
2pg3_A 232 Queuosine biosynthesis protein QUEC; YP_049261.1, 89.66
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 89.26
3k32_A 203 Uncharacterized protein MJ0690; predicted subunit 87.29
2c5s_A 413 THII, probable thiamine biosynthesis protein THII; 87.02
2o8v_A 252 Phosphoadenosine phosphosulfate reductase; disulfi 86.41
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 86.32
1ct9_A 553 Asparagine synthetase B; amidotransferase, substra 86.08
1vl2_A 421 Argininosuccinate synthase; TM1780, structural gen 85.35
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 84.25
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 84.2
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 83.76
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 83.5
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 82.36
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 81.76
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
Probab=99.93  E-value=4.4e-26  Score=210.89  Aligned_cols=117  Identities=28%  Similarity=0.447  Sum_probs=97.5

Q ss_pred             EEeeeccccccccccccceecc-----cccccccccccEEEEeecccccCChhhHHHHHHHHHHhhCCCCCcccchHHHH
Q psy7151          37 IKTHHNDSPLIRALREQGKVIE-----PLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEE  111 (188)
Q Consensus        37 V~s~H~~~~Lf~~lp~~s~vi~-----pi~Ai~~~~~~i~GVQFHPE~~~t~~G~~il~nFl~~i~~~~~~W~~~~~ie~  111 (188)
                      ++++|++.  +..+|+++.+++     +++|+++.++++||+|||||+.+|+.|.+||+||+..+|+|+++|+|++++++
T Consensus       139 v~~~H~~~--V~~lp~g~~v~A~s~~~~i~ai~~~~~~i~gvQFHPE~~~~~~g~~ll~nF~~~i~~~~~~~~~~~~~~~  216 (525)
T 1gpm_A          139 VWMSHGDK--VTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDD  216 (525)
T ss_dssp             EEEEECSE--EEECCTTCEEEEECSSCSCSEEEETTTTEEEESBCTTSTTSTTHHHHHHHHHHTTSCCCCCCCHHHHHHH
T ss_pred             EEEEccce--eeeCCCCCEEEEECCCCCEEEEEECCCCEEEEecCCCCCcchhHHHHHHHHHHhhhhccccchHHHHHHh
Confidence            44445554  455555555543     58899998889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCcEEEEeeccccCCChhhHhhcCC---CCCceEEEEecC
Q psy7151         112 LIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPF---PGPGLAIRVICG  158 (188)
Q Consensus       112 iI~~IRe~Vg~~kVi~~~~GlSGGvDSavva~~~~---p~~~L~v~~~~~  158 (188)
                      ++++||++++++++++   |+|||+||+|++.++.   ..+..++.++..
T Consensus       217 ~~~~ir~~v~~~~vvv---alSGGvDSsv~a~ll~~a~G~~v~av~v~~g  263 (525)
T 1gpm_A          217 AVARIREQVGDDKVIL---GLSGGVDSSVTAMLLHRAIGKNLTCVFVDNG  263 (525)
T ss_dssp             HHHHHHHHHTTCEEEE---ECCSSHHHHHHHHHHHHHHGGGEEEEEEECS
T ss_pred             hhhhhhhhhcccceEE---EecCCCCHHHHHHHHHHHhCCCEEEEEEeCC
Confidence            9999999999998888   9999999999994332   246777877654



>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 8e-11
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 6e-09
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 1e-08
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 3e-08
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 8e-08
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 2e-05
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 6e-04
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 7e-04
d1gpma1197 c.26.2.1 (A:208-404) GMP synthetase, central domai 7e-04
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 0.001
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 0.003
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: GMP synthetase
species: Escherichia coli [TaxId: 562]
 Score = 56.5 bits (135), Expect = 8e-11
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 63  FHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTG 101
              +E R YG+QFHPEV  T +G  ML+ F+ D+C    
Sbjct: 166 MANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEA 204


>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 188 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.6
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.59
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.5
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.49
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.48
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.35
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 98.99
d1wxia1 274 NH3-dependent NAD+-synthetase {Escherichia coli [T 98.98
d1kqpa_ 271 NH3-dependent NAD+-synthetase {Bacillus subtilis [ 98.97
d1gpma1 197 GMP synthetase, central domain {Escherichia coli [ 98.94
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 98.74
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 98.71
d1xnga1 255 NH3-dependent NAD+-synthetase {Helicobacter pylori 98.68
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 98.55
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 98.23
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.13
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 97.92
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 97.86
d1vl2a1 168 Argininosuccinate synthetase, N-terminal domain {T 96.18
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 95.95
d1j20a1165 Argininosuccinate synthetase, N-terminal domain {T 95.88
d1k92a1 188 Argininosuccinate synthetase, N-terminal domain {E 95.58
d1wy5a1 216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 95.11
d1ni5a1 227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 95.09
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 95.09
d2c5sa1 218 Thiamine biosynthesis protein ThiI, C-terminal dom 94.7
d1zuna1 211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 93.39
d1jgta1 299 beta-Lactam synthetase {Streptomyces clavuligerus 90.19
d1ct9a1 324 Asparagine synthetase B, C-terminal domain {Escher 89.31
d2pg3a1 230 Queuosine biosynthesis protein QueC {Erwinia carot 88.76
d1q15a1 296 beta-Lactam synthetase {Pectobacterium carotovorum 83.94
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: GMP synthetase
species: Escherichia coli [TaxId: 562]
Probab=99.60  E-value=1.4e-16  Score=127.25  Aligned_cols=84  Identities=31%  Similarity=0.489  Sum_probs=64.7

Q ss_pred             eeecCCeEEecCcccCCcceeEEeeecccccccccccc-------ce------------------ec-----cccccccc
Q psy7151          16 GTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQ-------GK------------------VI-----EPLKDFHK   65 (188)
Q Consensus        16 g~~~g~~I~~~~~~~HGk~~~V~s~H~~~~Lf~~lp~~-------s~------------------vi-----~pi~Ai~~   65 (188)
                      +.+||+.+.+++.+.||....+  .|....++.+++..       ++                  +.     .+.+++.+
T Consensus        91 a~~~Gg~v~~~~~~~~G~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~  168 (205)
T d1gpma2          91 AMQLGGHVEASNEREFGYAQVE--VVNDSALVRGIEDALTADGKPLLDVWMSHGDKVTAIPSDFITVASTESCPFAIMAN  168 (205)
T ss_dssp             HHHHTCEEECCSSCEEEEEEEE--ECSCCTTTTTCCSEECTTSCEEEEEEEEECSEEEECCTTCEEEEECSSCSCSEEEE
T ss_pred             hhhcCCccccccccccCcceec--cccccccccccccccccCCccceeeecccccccccccccceeeeccCCCceEEEEe
Confidence            4578999999999999987766  45555555544311       11                  00     12566777


Q ss_pred             ccccEEEEeecccccCChhhHHHHHHHHHHhhCCCC
Q psy7151          66 DELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTG  101 (188)
Q Consensus        66 ~~~~i~GVQFHPE~~~t~~G~~il~nFl~~i~~~~~  101 (188)
                      .++++||||||||+++|++|.+||+||+..||+|++
T Consensus       169 ~~~ni~gvQFHPE~s~s~~G~~il~nFl~~i~~~~~  204 (205)
T d1gpma2         169 EEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEA  204 (205)
T ss_dssp             TTTTEEEESBCTTSTTSTTHHHHHHHHHHTTSCCCC
T ss_pred             CCCCEEEEEeecccCCCccHHHHHHHHHHHHhCCcc
Confidence            788999999999999999999999999999999985



>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure