Psyllid ID: psy7151
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 188 | ||||||
| 270012865 | 687 | hypothetical protein TcasGA2_TC030725 [T | 0.664 | 0.181 | 0.473 | 3e-34 | |
| 189240082 | 748 | PREDICTED: similar to gmp synthase [Trib | 0.664 | 0.167 | 0.473 | 3e-34 | |
| 195388470 | 684 | GJ19601 [Drosophila virilis] gi|19414936 | 0.675 | 0.185 | 0.451 | 3e-32 | |
| 344237456 | 1159 | GMP synthase [glutamine-hydrolyzing] [Cr | 0.664 | 0.107 | 0.451 | 1e-31 | |
| 242013853 | 685 | GMP synthase, putative [Pediculus humanu | 0.675 | 0.185 | 0.462 | 2e-30 | |
| 380022489 | 716 | PREDICTED: GMP synthase [glutamine-hydro | 0.675 | 0.177 | 0.435 | 4e-30 | |
| 380022491 | 718 | PREDICTED: GMP synthase [glutamine-hydro | 0.675 | 0.176 | 0.435 | 4e-30 | |
| 66522082 | 718 | PREDICTED: GMP synthase [glutamine-hydro | 0.675 | 0.176 | 0.435 | 4e-30 | |
| 345480532 | 718 | PREDICTED: GMP synthase [glutamine-hydro | 0.675 | 0.176 | 0.446 | 5e-30 | |
| 307213208 | 718 | GMP synthase [glutamine-hydrolyzing] [Ha | 0.675 | 0.176 | 0.440 | 5e-30 |
| >gi|270012865|gb|EFA09313.1| hypothetical protein TcasGA2_TC030725 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 150 bits (378), Expect = 3e-34, Method: Compositional matrix adjust.
Identities = 89/188 (47%), Positives = 105/188 (55%), Gaps = 63/188 (33%)
Query: 1 MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
+ +L L P + +L QGTLRPDLIESAS L S+KAD IKTHHNDS L+R LR
Sbjct: 346 ISDLNLKPEEVVLAQGTLRPDLIESASALVSSKADTIKTHHNDSELVRKLR--------- 396
Query: 61 KDFHKDELRLYGLQFHPEVDLTNEGRTM--LKNFLFDVCGLTGNFTLKSREEELIKYVKE 118
+EGR + LK+F D
Sbjct: 397 ----------------------SEGRVVEPLKDFHKDE---------------------- 412
Query: 119 TVGNMKVLVRKLGLDLGLTPEVVMRHPFPGPGLAIRVICGEERYIEKDYSETQVLVKIIV 178
VR LG DLGLTPE+VMRHPFPGPGLAIRV+C EE Y+E+D+SETQVLVKIIV
Sbjct: 413 --------VRALGRDLGLTPELVMRHPFPGPGLAIRVLCAEEPYMERDFSETQVLVKIIV 464
Query: 179 EYDQMFKK 186
E+DQM +K
Sbjct: 465 EFDQMLQK 472
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189240082|ref|XP_001812886.1| PREDICTED: similar to gmp synthase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195388470|ref|XP_002052903.1| GJ19601 [Drosophila virilis] gi|194149360|gb|EDW65058.1| GJ19601 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|344237456|gb|EGV93559.1| GMP synthase [glutamine-hydrolyzing] [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|242013853|ref|XP_002427615.1| GMP synthase, putative [Pediculus humanus corporis] gi|212512030|gb|EEB14877.1| GMP synthase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|380022489|ref|XP_003695076.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380022491|ref|XP_003695077.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66522082|ref|XP_393336.2| PREDICTED: GMP synthase [glutamine-hydrolyzing] [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|345480532|ref|XP_003424167.1| PREDICTED: GMP synthase [glutamine-hydrolyzing]-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307213208|gb|EFN88703.1| GMP synthase [glutamine-hydrolyzing] [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 188 | ||||||
| ZFIN|ZDB-GENE-040426-1503 | 692 | gmps "guanine monphosphate syn | 0.404 | 0.109 | 0.701 | 6.7e-40 | |
| FB|FBgn0000239 | 720 | bur "burgundy" [Drosophila mel | 0.372 | 0.097 | 0.657 | 1.1e-38 | |
| MGI|MGI:2448526 | 693 | Gmps "guanine monophosphate sy | 0.414 | 0.112 | 0.658 | 4.8e-22 | |
| RGD|1310063 | 693 | Gmps "guanine monphosphate syn | 0.414 | 0.112 | 0.658 | 4.8e-22 | |
| UNIPROTKB|Q4V7C6 | 693 | Gmps "GMP synthase [glutamine- | 0.414 | 0.112 | 0.658 | 4.8e-22 | |
| UNIPROTKB|F1NAQ8 | 693 | GMPS "Uncharacterized protein" | 0.404 | 0.109 | 0.688 | 4.8e-22 | |
| UNIPROTKB|F8W720 | 594 | GMPS "GMP synthase [glutamine- | 0.404 | 0.127 | 0.675 | 5.5e-22 | |
| UNIPROTKB|J9NTM1 | 674 | GMPS "Uncharacterized protein" | 0.404 | 0.112 | 0.675 | 7.4e-22 | |
| UNIPROTKB|P49915 | 693 | GMPS "GMP synthase [glutamine- | 0.404 | 0.109 | 0.675 | 7.8e-22 | |
| UNIPROTKB|F1MC86 | 694 | GMPS "Uncharacterized protein" | 0.404 | 0.109 | 0.675 | 7.9e-22 |
| ZFIN|ZDB-GENE-040426-1503 gmps "guanine monphosphate synthetase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 272 (100.8 bits), Expect = 6.7e-40, Sum P(2) = 6.7e-40
Identities = 54/77 (70%), Positives = 61/77 (79%)
Query: 3 ELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPLKD 62
E+ L P L QGTLRPDLIESASHLAS KA+VIKTHHND+ LIR LR++GKVIEPLKD
Sbjct: 353 EMNLKPEDVYLAQGTLRPDLIESASHLASGKAEVIKTHHNDTELIRKLRDEGKVIEPLKD 412
Query: 63 FHKDELRLYGLQFH-PE 78
FHKDE+R G + PE
Sbjct: 413 FHKDEVRALGRELGLPE 429
|
|
| FB|FBgn0000239 bur "burgundy" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2448526 Gmps "guanine monophosphate synthetase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310063 Gmps "guanine monphosphate synthetase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4V7C6 Gmps "GMP synthase [glutamine-hydrolyzing]" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAQ8 GMPS "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W720 GMPS "GMP synthase [glutamine-hydrolyzing]" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NTM1 GMPS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49915 GMPS "GMP synthase [glutamine-hydrolyzing]" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MC86 GMPS "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 188 | |||
| cd01997 | 295 | cd01997, GMP_synthase_C, The C-terminal domain of | 2e-21 | |
| PRK00074 | 511 | PRK00074, guaA, GMP synthase; Reviewed | 1e-19 | |
| PLN02347 | 536 | PLN02347, PLN02347, GMP synthetase | 6e-14 | |
| PRK00074 | 511 | PRK00074, guaA, GMP synthase; Reviewed | 8e-14 | |
| cd01997 | 295 | cd01997, GMP_synthase_C, The C-terminal domain of | 6e-13 | |
| PRK00074 | 511 | PRK00074, guaA, GMP synthase; Reviewed | 1e-12 | |
| COG0519 | 315 | COG0519, GuaA, GMP synthase, PP-ATPase domain/subu | 3e-11 | |
| TIGR00884 | 311 | TIGR00884, guaA_Cterm, GMP synthase (glutamine-hyd | 1e-10 | |
| COG0519 | 315 | COG0519, GuaA, GMP synthase, PP-ATPase domain/subu | 2e-10 | |
| TIGR00884 | 311 | TIGR00884, guaA_Cterm, GMP synthase (glutamine-hyd | 4e-10 | |
| TIGR00888 | 188 | TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd | 2e-09 | |
| cd01742 | 181 | cd01742, GATase1_GMP_Synthase, Type 1 glutamine am | 2e-09 | |
| PLN02347 | 536 | PLN02347, PLN02347, GMP synthetase | 5e-09 | |
| PRK05670 | 189 | PRK05670, PRK05670, anthranilate synthase componen | 9e-08 | |
| PLN02347 | 536 | PLN02347, PLN02347, GMP synthetase | 1e-07 | |
| COG0518 | 198 | COG0518, GuaA, GMP synthase - Glutamine amidotrans | 2e-07 | |
| PRK00919 | 307 | PRK00919, PRK00919, GMP synthase subunit B; Valida | 3e-07 | |
| PRK00919 | 307 | PRK00919, PRK00919, GMP synthase subunit B; Valida | 6e-07 | |
| COG0512 | 191 | COG0512, PabA, Anthranilate/para-aminobenzoate syn | 1e-06 | |
| cd01743 | 184 | cd01743, GATase1_Anthranilate_Synthase, Type 1 glu | 2e-06 | |
| PRK00758 | 184 | PRK00758, PRK00758, GMP synthase subunit A; Valida | 2e-06 | |
| pfam00117 | 186 | pfam00117, GATase, Glutamine amidotransferase clas | 7e-06 | |
| PRK14607 | 534 | PRK14607, PRK14607, bifunctional glutamine amidotr | 2e-05 | |
| CHL00101 | 190 | CHL00101, trpG, anthranilate synthase component 2 | 2e-05 | |
| PRK07765 | 214 | PRK07765, PRK07765, para-aminobenzoate synthase co | 4e-05 | |
| PRK07649 | 195 | PRK07649, PRK07649, para-aminobenzoate/anthranilat | 7e-04 | |
| PLN02335 | 222 | PLN02335, PLN02335, anthranilate synthase | 0.001 |
| >gnl|CDD|238955 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase | Back alignment and domain information |
|---|
Score = 88.7 bits (221), Expect = 2e-21
Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
Query: 1 MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
++L L L QGTL PD+IES S S AD IK+HHN L + K+IEPL
Sbjct: 95 AKKLGLA---EYLAQGTLYPDVIESGSGKGS--ADTIKSHHNVGGLPE--DMKLKLIEPL 147
Query: 61 KDFHKDELRLYGLQF 75
+D KDE+R G +
Sbjct: 148 RDLFKDEVRELGREL 162
|
It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes. Length = 295 |
| >gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238955 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223593 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233169 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223593 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233169 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I | Back alignment and domain information |
|---|
| >gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214365 CHL00101, trpG, anthranilate synthase component 2 | Back alignment and domain information |
|---|
| >gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| PLN02347 | 536 | GMP synthetase | 99.94 | |
| PRK00074 | 511 | guaA GMP synthase; Reviewed | 99.93 | |
| KOG1622|consensus | 552 | 99.93 | ||
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 99.86 | |
| PRK09522 | 531 | bifunctional glutamine amidotransferase/anthranila | 99.68 | |
| KOG0026|consensus | 223 | 99.66 | ||
| PRK07765 | 214 | para-aminobenzoate synthase component II; Provisio | 99.64 | |
| PRK08007 | 187 | para-aminobenzoate synthase component II; Provisio | 99.58 | |
| PLN02889 | 918 | oxo-acid-lyase/anthranilate synthase | 99.56 | |
| TIGR00566 | 188 | trpG_papA glutamine amidotransferase of anthranila | 99.51 | |
| PRK07649 | 195 | para-aminobenzoate/anthranilate synthase glutamine | 99.48 | |
| PRK06774 | 191 | para-aminobenzoate synthase component II; Provisio | 99.47 | |
| PRK08857 | 193 | para-aminobenzoate synthase component II; Provisio | 99.46 | |
| TIGR00888 | 188 | guaA_Nterm GMP synthase (glutamine-hydrolyzing), N | 99.42 | |
| PRK05637 | 208 | anthranilate synthase component II; Provisional | 99.41 | |
| CHL00101 | 190 | trpG anthranilate synthase component 2 | 99.4 | |
| PRK06895 | 190 | putative anthranilate synthase component II; Provi | 99.39 | |
| KOG1224|consensus | 767 | 99.37 | ||
| PRK14607 | 534 | bifunctional glutamine amidotransferase/anthranila | 99.3 | |
| PLN02335 | 222 | anthranilate synthase | 99.3 | |
| KOG1622|consensus | 552 | 99.29 | ||
| PRK05670 | 189 | anthranilate synthase component II; Provisional | 99.24 | |
| TIGR01815 | 717 | TrpE-clade3 anthranilate synthase, alpha proteobac | 99.22 | |
| PRK00758 | 184 | GMP synthase subunit A; Validated | 99.22 | |
| TIGR01823 | 742 | PabB-fungal aminodeoxychorismate synthase, fungal | 99.21 | |
| cd01743 | 184 | GATase1_Anthranilate_Synthase Type 1 glutamine ami | 99.21 | |
| COG0519 | 315 | GuaA GMP synthase, PP-ATPase domain/subunit [Nucle | 99.2 | |
| cd01742 | 181 | GATase1_GMP_Synthase Type 1 glutamine amidotransfe | 99.19 | |
| COG0519 | 315 | GuaA GMP synthase, PP-ATPase domain/subunit [Nucle | 99.16 | |
| PRK13566 | 720 | anthranilate synthase; Provisional | 99.13 | |
| COG0518 | 198 | GuaA GMP synthase - Glutamine amidotransferase dom | 99.13 | |
| PRK11366 | 254 | puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; | 99.06 | |
| cd01745 | 189 | GATase1_2 Subgroup of proteins having the Type 1 g | 99.03 | |
| cd01748 | 198 | GATase1_IGP_Synthase Type 1 glutamine amidotransfe | 99.01 | |
| cd01744 | 178 | GATase1_CPSase Small chain of the glutamine-depend | 99.0 | |
| CHL00188 | 210 | hisH imidazole glycerol phosphate synthase subunit | 98.97 | |
| PRK12564 | 360 | carbamoyl phosphate synthase small subunit; Review | 98.86 | |
| PF00117 | 192 | GATase: Glutamine amidotransferase class-I; InterP | 98.85 | |
| PRK13181 | 199 | hisH imidazole glycerol phosphate synthase subunit | 98.83 | |
| COG2071 | 243 | Predicted glutamine amidotransferases [General fun | 98.8 | |
| PRK14004 | 210 | hisH imidazole glycerol phosphate synthase subunit | 98.8 | |
| PRK12838 | 354 | carbamoyl phosphate synthase small subunit; Review | 98.79 | |
| TIGR01855 | 196 | IMP_synth_hisH imidazole glycerol phosphate syntha | 98.79 | |
| PRK13146 | 209 | hisH imidazole glycerol phosphate synthase subunit | 98.78 | |
| PRK13152 | 201 | hisH imidazole glycerol phosphate synthase subunit | 98.77 | |
| PRK13141 | 205 | hisH imidazole glycerol phosphate synthase subunit | 98.72 | |
| TIGR01368 | 358 | CPSaseIIsmall carbamoyl-phosphate synthase, small | 98.7 | |
| PRK00768 | 268 | nadE NAD synthetase; Reviewed | 98.61 | |
| PRK13170 | 196 | hisH imidazole glycerol phosphate synthase subunit | 98.6 | |
| PTZ00323 | 294 | NAD+ synthase; Provisional | 98.57 | |
| PF02540 | 242 | NAD_synthase: NAD synthase; InterPro: IPR022310 NA | 98.54 | |
| COG0171 | 268 | NadE NAD synthase [Coenzyme metabolism] | 98.48 | |
| PRK13143 | 200 | hisH imidazole glycerol phosphate synthase subunit | 98.46 | |
| CHL00197 | 382 | carA carbamoyl-phosphate synthase arginine-specifi | 98.45 | |
| COG0118 | 204 | HisH Glutamine amidotransferase [Amino acid transp | 98.42 | |
| TIGR01737 | 227 | FGAM_synth_I phosphoribosylformylglycinamidine syn | 98.39 | |
| PRK00919 | 307 | GMP synthase subunit B; Validated | 98.27 | |
| PLN02347 | 536 | GMP synthetase | 98.25 | |
| PF07722 | 217 | Peptidase_C26: Peptidase C26; InterPro: IPR011697 | 98.25 | |
| cd01741 | 188 | GATase1_1 Subgroup of proteins having the Type 1 g | 98.23 | |
| PRK13525 | 189 | glutamine amidotransferase subunit PdxT; Provision | 98.2 | |
| PLN02771 | 415 | carbamoyl-phosphate synthase (glutamine-hydrolyzin | 98.2 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 98.13 | |
| PRK13527 | 200 | glutamine amidotransferase subunit PdxT; Provision | 98.11 | |
| cd01746 | 235 | GATase1_CTP_Synthase Type 1 glutamine amidotransfe | 98.08 | |
| cd00553 | 248 | NAD_synthase NAD+ synthase is a homodimer, which c | 98.07 | |
| PRK13142 | 192 | hisH imidazole glycerol phosphate synthase subunit | 98.06 | |
| PRK13980 | 265 | NAD synthetase; Provisional | 98.03 | |
| cd01747 | 273 | GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot | 97.98 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 97.95 | |
| TIGR00884 | 311 | guaA_Cterm GMP synthase (glutamine-hydrolyzing), C | 97.88 | |
| PRK09065 | 237 | glutamine amidotransferase; Provisional | 97.82 | |
| PRK00876 | 326 | nadE NAD synthetase; Reviewed | 97.81 | |
| PRK06186 | 229 | hypothetical protein; Validated | 97.8 | |
| PRK06490 | 239 | glutamine amidotransferase; Provisional | 97.78 | |
| PRK13981 | 540 | NAD synthetase; Provisional | 97.77 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 97.68 | |
| PLN02327 | 557 | CTP synthase | 97.59 | |
| TIGR03800 | 184 | PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl | 97.54 | |
| PRK05665 | 240 | amidotransferase; Provisional | 97.51 | |
| PRK08250 | 235 | glutamine amidotransferase; Provisional | 97.47 | |
| TIGR00552 | 250 | nadE NAD+ synthetase. NAD+ synthetase is a nearly | 97.45 | |
| PRK03619 | 219 | phosphoribosylformylglycinamidine synthase I; Prov | 97.35 | |
| PRK02628 | 679 | nadE NAD synthetase; Reviewed | 97.34 | |
| PRK07053 | 234 | glutamine amidotransferase; Provisional | 97.23 | |
| PRK07567 | 242 | glutamine amidotransferase; Provisional | 97.2 | |
| TIGR00884 | 311 | guaA_Cterm GMP synthase (glutamine-hydrolyzing), C | 97.07 | |
| PLN02339 | 700 | NAD+ synthase (glutamine-hydrolysing) | 97.03 | |
| COG0505 | 368 | CarA Carbamoylphosphate synthase small subunit [Am | 97.02 | |
| cd01749 | 183 | GATase1_PB Glutamine Amidotransferase (GATase_I) i | 96.85 | |
| cd01997 | 295 | GMP_synthase_C The C-terminal domain of GMP synthe | 96.79 | |
| PLN02832 | 248 | glutamine amidotransferase subunit of pyridoxal 5' | 96.56 | |
| TIGR03573 | 343 | WbuX N-acetyl sugar amidotransferase. This enzyme | 95.89 | |
| KOG0370|consensus | 1435 | 95.66 | ||
| KOG1559|consensus | 340 | 94.78 | ||
| TIGR00268 | 252 | conserved hypothetical protein TIGR00268. The N-te | 94.78 | |
| COG0482 | 356 | TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid | 94.7 | |
| COG1606 | 269 | ATP-utilizing enzymes of the PP-loop superfamily [ | 94.64 | |
| PRK00919 | 307 | GMP synthase subunit B; Validated | 94.54 | |
| PF03054 | 356 | tRNA_Me_trans: tRNA methyl transferase; InterPro: | 94.23 | |
| cd01997 | 295 | GMP_synthase_C The C-terminal domain of GMP synthe | 94.04 | |
| KOG2805|consensus | 377 | 93.57 | ||
| cd01996 | 154 | Alpha_ANH_like_III This is a subfamily of Adenine | 93.56 | |
| PRK14665 | 360 | mnmA tRNA-specific 2-thiouridylase MnmA; Provision | 93.5 | |
| cd01712 | 177 | ThiI ThiI is required for thiazole synthesis in th | 93.17 | |
| PRK00074 | 511 | guaA GMP synthase; Reviewed | 93.02 | |
| KOG0623|consensus | 541 | 92.72 | ||
| PRK14664 | 362 | tRNA-specific 2-thiouridylase MnmA; Provisional | 92.46 | |
| cd01991 | 269 | Asn_Synthase_B_C The C-terminal domain of Asparagi | 91.81 | |
| PRK13795 | 636 | hypothetical protein; Provisional | 91.2 | |
| cd01986 | 103 | Alpha_ANH_like Adenine nucleotide alpha hydrolases | 90.96 | |
| TIGR00364 | 201 | exsB protein. This protein family is represented b | 90.95 | |
| PRK10696 | 258 | tRNA 2-thiocytidine biosynthesis protein TtcA; Pro | 90.93 | |
| PF00733 | 255 | Asn_synthase: Asparagine synthase; InterPro: IPR00 | 90.74 | |
| TIGR02432 | 189 | lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t | 90.71 | |
| COG0037 | 298 | MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle | 90.53 | |
| PRK05253 | 301 | sulfate adenylyltransferase subunit 2; Provisional | 90.19 | |
| PRK08349 | 198 | hypothetical protein; Validated | 89.17 | |
| cd01998 | 349 | tRNA_Me_trans tRNA methyl transferase. This family | 89.16 | |
| cd01993 | 185 | Alpha_ANH_like_II This is a subfamily of Adenine n | 88.97 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 88.97 | |
| PRK00143 | 346 | mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed | 88.91 | |
| TIGR00420 | 352 | trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me | 88.77 | |
| PF01171 | 182 | ATP_bind_3: PP-loop family; InterPro: IPR011063 Th | 88.57 | |
| PRK01565 | 394 | thiamine biosynthesis protein ThiI; Provisional | 88.53 | |
| cd01992 | 185 | PP-ATPase N-terminal domain of predicted ATPase of | 87.93 | |
| cd01995 | 169 | ExsB ExsB is a transcription regulator related pro | 87.74 | |
| PTZ00077 | 586 | asparagine synthetase-like protein; Provisional | 87.55 | |
| TIGR00342 | 371 | thiazole biosynthesis/tRNA modification protein Th | 87.44 | |
| cd01990 | 202 | Alpha_ANH_like_I This is a subfamily of Adenine nu | 87.4 | |
| cd01713 | 173 | PAPS_reductase This domain is found in phosphoaden | 86.88 | |
| TIGR01536 | 467 | asn_synth_AEB asparagine synthase (glutamine-hydro | 86.63 | |
| PRK13794 | 479 | hypothetical protein; Provisional | 86.59 | |
| PRK08384 | 381 | thiamine biosynthesis protein ThiI; Provisional | 86.42 | |
| PRK10660 | 436 | tilS tRNA(Ile)-lysidine synthetase; Provisional | 85.9 | |
| PRK11106 | 231 | queuosine biosynthesis protein QueC; Provisional | 85.44 | |
| PRK09431 | 554 | asnB asparagine synthetase B; Provisional | 85.27 | |
| PRK14561 | 194 | hypothetical protein; Provisional | 85.26 | |
| PLN02549 | 578 | asparagine synthase (glutamine-hydrolyzing) | 85.26 | |
| PRK13820 | 394 | argininosuccinate synthase; Provisional | 83.9 | |
| PLN00200 | 404 | argininosuccinate synthase; Provisional | 83.42 | |
| PRK04527 | 400 | argininosuccinate synthase; Provisional | 83.3 | |
| PRK00509 | 399 | argininosuccinate synthase; Provisional | 83.27 | |
| PRK08576 | 438 | hypothetical protein; Provisional | 82.91 | |
| TIGR03108 | 628 | eps_aminotran_1 exosortase 1 system-associated ami | 81.94 | |
| COG1365 | 255 | Predicted ATPase (PP-loop superfamily) [General fu | 81.33 | |
| TIGR00032 | 394 | argG argininosuccinate synthase. argG in bacteria, | 81.15 |
| >PLN02347 GMP synthetase | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.9e-27 Score=222.80 Aligned_cols=137 Identities=26% Similarity=0.391 Sum_probs=111.8
Q ss_pred eeecCCeEEecCcccCCcceeEEeeeccccccccccc-------------------cceecc-----cccccccccccEE
Q psy7151 16 GTLRPDLIESASHLASNKADVIKTHHNDSPLIRALRE-------------------QGKVIE-----PLKDFHKDELRLY 71 (188)
Q Consensus 16 g~~~g~~I~~~~~~~HGk~~~V~s~H~~~~Lf~~lp~-------------------~s~vi~-----pi~Ai~~~~~~i~ 71 (188)
+.++|+.|.+.+.+.||..... .+.+.+||+++|. ++.+++ +++|+++.++++|
T Consensus 100 a~alGG~V~~~~~~e~G~~~v~--i~~~~~Lf~~l~~~~~~~v~~~Hsd~V~~lP~g~~vlA~s~~~~iaai~~~~~~i~ 177 (536)
T PLN02347 100 VQKLGGEVKPGEKQEYGRMEIR--VVCGSQLFGDLPSGETQTVWMSHGDEAVKLPEGFEVVAKSVQGAVVAIENRERRIY 177 (536)
T ss_pred HHHcCCEEEecCCcccceEEEE--EcCCChhhhcCCCCceEEEEEEEEEEeeeCCCCCEEEEEeCCCcEEEEEECCCCEE
Confidence 3468999999988889987643 2445556666642 222222 4789998889999
Q ss_pred EEeecccccCChhhHHHHHHHHHHhhCCCCCcccchHHHHHHHHHHHHhC-CCcEEEEeeccccCCChhhHhhcCC---C
Q psy7151 72 GLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEELIKYVKETVG-NMKVLVRKLGLDLGLTPEVVMRHPF---P 147 (188)
Q Consensus 72 GVQFHPE~~~t~~G~~il~nFl~~i~~~~~~W~~~~~ie~iI~~IRe~Vg-~~kVi~~~~GlSGGvDSavva~~~~---p 147 (188)
|+|||||+.+|+.|.+||+||+..+|+|+++|+|++++++.++.||++++ +++|++ |+||||||+|+|.++. .
T Consensus 178 GvQFHPE~~~t~~G~~iL~NFl~~ic~~~~~~~~~~~~~~~i~~i~~~~~~~~~vvv---alSGGVDSsvla~l~~~alG 254 (536)
T PLN02347 178 GLQYHPEVTHSPKGMETLRHFLFDVCGVTADWKMQDVLEEQIELIKATVGPDEHVIC---ALSGGVDSTVAATLVHKAIG 254 (536)
T ss_pred EEEccCCCCccchHHHHHHHHHHHHhCcCCCcCcchHHHHHHHHHHHHhccCCeEEE---EecCChhHHHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999999999999999 567888 9999999999994443 3
Q ss_pred CCceEEEEec
Q psy7151 148 GPGLAIRVIC 157 (188)
Q Consensus 148 ~~~L~v~~~~ 157 (188)
++.+++-+..
T Consensus 255 ~~v~av~id~ 264 (536)
T PLN02347 255 DRLHCVFVDN 264 (536)
T ss_pred CcEEEEEEeC
Confidence 5677777653
|
|
| >PRK00074 guaA GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >KOG1622|consensus | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0026|consensus | Back alignment and domain information |
|---|
| >PRK07765 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK08007 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PLN02889 oxo-acid-lyase/anthranilate synthase | Back alignment and domain information |
|---|
| >TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase | Back alignment and domain information |
|---|
| >PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated | Back alignment and domain information |
|---|
| >PRK06774 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK08857 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit | Back alignment and domain information |
|---|
| >PRK05637 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >CHL00101 trpG anthranilate synthase component 2 | Back alignment and domain information |
|---|
| >PRK06895 putative anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >KOG1224|consensus | Back alignment and domain information |
|---|
| >PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02335 anthranilate synthase | Back alignment and domain information |
|---|
| >KOG1622|consensus | Back alignment and domain information |
|---|
| >PRK05670 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade | Back alignment and domain information |
|---|
| >PRK00758 GMP synthase subunit A; Validated | Back alignment and domain information |
|---|
| >TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade | Back alignment and domain information |
|---|
| >cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase | Back alignment and domain information |
|---|
| >COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase | Back alignment and domain information |
|---|
| >COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13566 anthranilate synthase; Provisional | Back alignment and domain information |
|---|
| >COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) | Back alignment and domain information |
|---|
| >cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II | Back alignment and domain information |
|---|
| >CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional | Back alignment and domain information |
|---|
| >PRK12564 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] | Back alignment and domain information |
|---|
| >PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >COG2071 Predicted glutamine amidotransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK12838 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit | Back alignment and domain information |
|---|
| >PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK00768 nadE NAD synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PTZ00323 NAD+ synthase; Provisional | Back alignment and domain information |
|---|
| >PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 | Back alignment and domain information |
|---|
| >COG0171 NadE NAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I | Back alignment and domain information |
|---|
| >PRK00919 GMP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >PLN02347 GMP synthetase | Back alignment and domain information |
|---|
| >PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >PRK13525 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK13527 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase | Back alignment and domain information |
|---|
| >cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) | Back alignment and domain information |
|---|
| >PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13980 NAD synthetase; Provisional | Back alignment and domain information |
|---|
| >cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit | Back alignment and domain information |
|---|
| >PRK09065 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00876 nadE NAD synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK06186 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06490 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13981 NAD synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 | Back alignment and domain information |
|---|
| >PRK05665 amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08250 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00552 nadE NAD+ synthetase | Back alignment and domain information |
|---|
| >PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional | Back alignment and domain information |
|---|
| >PRK02628 nadE NAD synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK07053 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07567 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit | Back alignment and domain information |
|---|
| >PLN02339 NAD+ synthase (glutamine-hydrolysing) | Back alignment and domain information |
|---|
| >COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis | Back alignment and domain information |
|---|
| >cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase | Back alignment and domain information |
|---|
| >PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex | Back alignment and domain information |
|---|
| >TIGR03573 WbuX N-acetyl sugar amidotransferase | Back alignment and domain information |
|---|
| >KOG0370|consensus | Back alignment and domain information |
|---|
| >KOG1559|consensus | Back alignment and domain information |
|---|
| >TIGR00268 conserved hypothetical protein TIGR00268 | Back alignment and domain information |
|---|
| >COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00919 GMP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 | Back alignment and domain information |
|---|
| >cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase | Back alignment and domain information |
|---|
| >KOG2805|consensus | Back alignment and domain information |
|---|
| >cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional | Back alignment and domain information |
|---|
| >cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway | Back alignment and domain information |
|---|
| >PRK00074 guaA GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >KOG0623|consensus | Back alignment and domain information |
|---|
| >PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional | Back alignment and domain information |
|---|
| >cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B | Back alignment and domain information |
|---|
| >PRK13795 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases | Back alignment and domain information |
|---|
| >TIGR00364 exsB protein | Back alignment and domain information |
|---|
| >PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional | Back alignment and domain information |
|---|
| >PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO) | Back alignment and domain information |
|---|
| >TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain | Back alignment and domain information |
|---|
| >COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05253 sulfate adenylyltransferase subunit 2; Provisional | Back alignment and domain information |
|---|
| >PRK08349 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01998 tRNA_Me_trans tRNA methyl transferase | Back alignment and domain information |
|---|
| >cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase | Back alignment and domain information |
|---|
| >PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] | Back alignment and domain information |
|---|
| >PRK01565 thiamine biosynthesis protein ThiI; Provisional | Back alignment and domain information |
|---|
| >cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01995 ExsB ExsB is a transcription regulator related protein | Back alignment and domain information |
|---|
| >PTZ00077 asparagine synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI | Back alignment and domain information |
|---|
| >cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase | Back alignment and domain information |
|---|
| >TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing) | Back alignment and domain information |
|---|
| >PRK13794 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08384 thiamine biosynthesis protein ThiI; Provisional | Back alignment and domain information |
|---|
| >PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11106 queuosine biosynthesis protein QueC; Provisional | Back alignment and domain information |
|---|
| >PRK09431 asnB asparagine synthetase B; Provisional | Back alignment and domain information |
|---|
| >PRK14561 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02549 asparagine synthase (glutamine-hydrolyzing) | Back alignment and domain information |
|---|
| >PRK13820 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN00200 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK04527 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00509 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08576 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 | Back alignment and domain information |
|---|
| >COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00032 argG argininosuccinate synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 188 | ||||
| 2vxo_A | 697 | Human Gmp Synthetase In Complex With Xmp Length = 6 | 5e-24 | ||
| 2vxo_A | 697 | Human Gmp Synthetase In Complex With Xmp Length = 6 | 4e-15 | ||
| 2vpi_A | 218 | Human Gmp Synthetase - Glutaminase Domain Length = | 2e-09 | ||
| 1gpm_A | 525 | Escherichia Coli Gmp Synthetase Complexed With Amp | 7e-09 | ||
| 1gpm_A | 525 | Escherichia Coli Gmp Synthetase Complexed With Amp | 7e-08 | ||
| 1gpm_A | 525 | Escherichia Coli Gmp Synthetase Complexed With Amp | 3e-06 | ||
| 3tqi_A | 527 | Structure Of The Gmp Synthase (Guaa) From Coxiella | 4e-08 | ||
| 3uow_A | 556 | Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr | 7e-08 | ||
| 3uow_A | 556 | Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr | 3e-05 | ||
| 2ywc_A | 503 | Crystal Structure Of Gmp Synthetase From Thermus Th | 1e-06 | ||
| 2ywc_A | 503 | Crystal Structure Of Gmp Synthetase From Thermus Th | 1e-04 | ||
| 2ywb_A | 503 | Crystal Structure Of Gmp Synthetase From Thermus Th | 1e-06 | ||
| 2ywb_A | 503 | Crystal Structure Of Gmp Synthetase From Thermus Th | 1e-04 | ||
| 2dpl_A | 308 | Crystal Structure Of The Gmp Synthase From Pyrococc | 1e-05 | ||
| 1wl8_A | 189 | Crystal Structure Of Ph1346 Protein From Pyrococcus | 4e-04 | ||
| 2d7j_A | 209 | Crystal Structure Analysis Of Glutamine Amidotransf | 5e-04 |
| >pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 | Back alignment and structure |
|
| >pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 | Back alignment and structure |
| >pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 | Back alignment and structure |
| >pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 | Back alignment and structure |
| >pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 | Back alignment and structure |
| >pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 | Back alignment and structure |
| >pdb|3TQI|A Chain A, Structure Of The Gmp Synthase (Guaa) From Coxiella Burnetii Length = 527 | Back alignment and structure |
| >pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 | Back alignment and structure |
| >pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 | Back alignment and structure |
| >pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 | Back alignment and structure |
| >pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 | Back alignment and structure |
| >pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 | Back alignment and structure |
| >pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 | Back alignment and structure |
| >pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308 | Back alignment and structure |
| >pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 | Back alignment and structure |
| >pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 188 | |||
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 5e-30 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 2e-26 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 3e-19 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 5e-20 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 2e-13 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 3e-11 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 6e-20 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 2e-13 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 6e-11 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 1e-19 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 1e-13 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 5e-13 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 9e-18 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 2e-13 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 4e-11 | |
| 2vpi_A | 218 | GMP synthase; guanine monophosphate synthetase, ph | 5e-16 | |
| 2a9v_A | 212 | GMP synthase; structural genomics, joint center fo | 9e-13 | |
| 2dpl_A | 308 | GMP synthetase, GMP synthase [glutamine-hydrolyzin | 1e-12 | |
| 2dpl_A | 308 | GMP synthetase, GMP synthase [glutamine-hydrolyzin | 1e-09 | |
| 1wl8_A | 189 | GMP synthase [glutamine-hydrolyzing] subunit A; tr | 7e-09 | |
| 1i1q_B | 192 | Anthranilate synthase component II; tryptophan bio | 6e-08 | |
| 1qdl_B | 195 | Protein (anthranilate synthase (TRPG-SUBUNIT)); tr | 2e-07 |
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 | Back alignment and structure |
|---|
Score = 114 bits (288), Expect = 5e-30
Identities = 50/74 (67%), Positives = 61/74 (82%)
Query: 1 MEELKLDPNQTLLCQGTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQGKVIEPL 60
+ E+ L P + L QGTLRPDLIESAS +AS KA++IKTHHND+ LIR LRE+GKVIEPL
Sbjct: 356 IGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPL 415
Query: 61 KDFHKDELRLYGLQ 74
KDFHKDE+R+ G +
Sbjct: 416 KDFHKDEVRILGRE 429
|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 | Back alignment and structure |
|---|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 | Back alignment and structure |
|---|
| >2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 | Back alignment and structure |
|---|
| >2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Length = 308 | Back alignment and structure |
|---|
| >2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Length = 308 | Back alignment and structure |
|---|
| >1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 | Back alignment and structure |
|---|
| >1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 | Back alignment and structure |
|---|
| >1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 99.93 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 99.92 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 99.92 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 99.91 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 99.9 | |
| 2vpi_A | 218 | GMP synthase; guanine monophosphate synthetase, ph | 99.52 | |
| 2a9v_A | 212 | GMP synthase; structural genomics, joint center fo | 99.3 | |
| 1i1q_B | 192 | Anthranilate synthase component II; tryptophan bio | 99.29 | |
| 1qdl_B | 195 | Protein (anthranilate synthase (TRPG-SUBUNIT)); tr | 99.14 | |
| 1wl8_A | 189 | GMP synthase [glutamine-hydrolyzing] subunit A; tr | 99.13 | |
| 4gud_A | 211 | Imidazole glycerol phosphate synthase subunit His; | 99.05 | |
| 3r75_A | 645 | Anthranilate/para-aminobenzoate synthases compone; | 99.05 | |
| 3fij_A | 254 | LIN1909 protein; 11172J, uncharacterized protein, | 98.93 | |
| 2v4u_A | 289 | CTP synthase 2; pyrimidine biosynthesis, glutamine | 98.84 | |
| 3d54_D | 213 | Phosphoribosylformylglycinamidine synthase 1; alph | 98.81 | |
| 3q4g_A | 279 | NH(3)-dependent NAD(+) synthetase; structural geno | 98.77 | |
| 2w7t_A | 273 | CTP synthetase, putative cytidine triphosphate syn | 98.77 | |
| 1a9x_B | 379 | Carbamoyl phosphate synthetase (small chain); amid | 98.68 | |
| 1gpw_B | 201 | Amidotransferase HISH; lyase/transferase, complex | 98.63 | |
| 1wxi_A | 275 | NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l | 98.6 | |
| 2ywj_A | 186 | Glutamine amidotransferase subunit PDXT; uncharact | 98.57 | |
| 1kqp_A | 271 | NAD+ synthase, NH(3)-dependent NAD(+) synthetase, | 98.47 | |
| 1l9x_A | 315 | Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO | 98.46 | |
| 3dpi_A | 285 | NAD+ synthetase; ssgcid, decode, structural genomi | 98.39 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 98.37 | |
| 3fiu_A | 249 | NH(3)-dependent NAD(+) synthetase; rossman fold, a | 98.31 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 98.24 | |
| 3m3p_A | 250 | Glutamine amido transferase; structural genomics, | 98.23 | |
| 3l7n_A | 236 | Putative uncharacterized protein; glutamine amidot | 98.13 | |
| 1ka9_H | 200 | Imidazole glycerol phosphtate synthase; riken stru | 98.11 | |
| 1o1y_A | 239 | Conserved hypothetical protein TM1158; flavodoxin- | 98.09 | |
| 2dpl_A | 308 | GMP synthetase, GMP synthase [glutamine-hydrolyzin | 98.0 | |
| 2nv0_A | 196 | Glutamine amidotransferase subunit PDXT; 3-layer(A | 97.99 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 97.99 | |
| 2e18_A | 257 | NH(3)-dependent NAD(+) synthetase; ligase, structu | 97.97 | |
| 3p52_A | 249 | NH(3)-dependent NAD(+) synthetase; structural geno | 97.97 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 97.94 | |
| 1xng_A | 268 | NH(3)-dependent NAD(+) synthetase; amidotransferas | 97.9 | |
| 2ywd_A | 191 | Glutamine amidotransferase subunit PDXT; pyridoxin | 97.86 | |
| 1q7r_A | 219 | Predicted amidotransferase; structural genomics, Y | 97.86 | |
| 2iss_D | 208 | Glutamine amidotransferase subunit PDXT; (beta/alp | 97.81 | |
| 3n05_A | 590 | NH(3)-dependent NAD(+) synthetase; ligase, structu | 97.74 | |
| 4f4h_A | 565 | Glutamine dependent NAD+ synthetase; structural ge | 97.53 | |
| 2abw_A | 227 | PDX2 protein, glutaminase; PLP-synthase, vitamin B | 97.24 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 96.84 | |
| 3ilv_A | 634 | Glutamine-dependent NAD(+) synthetase; protein str | 96.8 | |
| 3sdb_A | 680 | Glutamine-dependent NAD(+) synthetase; glutamine-a | 96.79 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 96.53 | |
| 1wy5_A | 317 | TILS, hypothetical UPF0072 protein AQ_1887; N-type | 94.24 | |
| 1jgt_A | 513 | Beta-lactam synthetase; asparagine synthetase, cla | 92.33 | |
| 1sur_A | 215 | PAPS reductase; assimilatory sulfate reduction, 3- | 91.65 | |
| 1q15_A | 503 | CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, | 91.51 | |
| 3bl5_A | 219 | Queuosine biosynthesis protein QUEC; PREQ1 biosynt | 91.47 | |
| 2der_A | 380 | TRNA-specific 2-thiouridylase MNMA; protein-RNA co | 91.46 | |
| 2pg3_A | 232 | Queuosine biosynthesis protein QUEC; YP_049261.1, | 89.66 | |
| 2hma_A | 376 | Probable tRNA (5-methylaminomethyl-2-thiouridylat | 89.26 | |
| 3k32_A | 203 | Uncharacterized protein MJ0690; predicted subunit | 87.29 | |
| 2c5s_A | 413 | THII, probable thiamine biosynthesis protein THII; | 87.02 | |
| 2o8v_A | 252 | Phosphoadenosine phosphosulfate reductase; disulfi | 86.41 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 86.32 | |
| 1ct9_A | 553 | Asparagine synthetase B; amidotransferase, substra | 86.08 | |
| 1vl2_A | 421 | Argininosuccinate synthase; TM1780, structural gen | 85.35 | |
| 1ni5_A | 433 | Putative cell cycle protein MESJ; structural genom | 84.25 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 84.2 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 83.76 | |
| 3a2k_A | 464 | TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, | 83.5 | |
| 2vdj_A | 301 | Homoserine O-succinyltransferase; methionine biosy | 82.36 | |
| 2h2w_A | 312 | Homoserine O-succinyltransferase; TM0881, (EC 2.3. | 81.76 |
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 | Back alignment and structure |
|---|
Probab=99.93 E-value=4.4e-26 Score=210.89 Aligned_cols=117 Identities=28% Similarity=0.447 Sum_probs=97.5
Q ss_pred EEeeeccccccccccccceecc-----cccccccccccEEEEeecccccCChhhHHHHHHHHHHhhCCCCCcccchHHHH
Q psy7151 37 IKTHHNDSPLIRALREQGKVIE-----PLKDFHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTGNFTLKSREEE 111 (188)
Q Consensus 37 V~s~H~~~~Lf~~lp~~s~vi~-----pi~Ai~~~~~~i~GVQFHPE~~~t~~G~~il~nFl~~i~~~~~~W~~~~~ie~ 111 (188)
++++|++. +..+|+++.+++ +++|+++.++++||+|||||+.+|+.|.+||+||+..+|+|+++|+|++++++
T Consensus 139 v~~~H~~~--V~~lp~g~~v~A~s~~~~i~ai~~~~~~i~gvQFHPE~~~~~~g~~ll~nF~~~i~~~~~~~~~~~~~~~ 216 (525)
T 1gpm_A 139 VWMSHGDK--VTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDD 216 (525)
T ss_dssp EEEEECSE--EEECCTTCEEEEECSSCSCSEEEETTTTEEEESBCTTSTTSTTHHHHHHHHHHTTSCCCCCCCHHHHHHH
T ss_pred EEEEccce--eeeCCCCCEEEEECCCCCEEEEEECCCCEEEEecCCCCCcchhHHHHHHHHHHhhhhccccchHHHHHHh
Confidence 44445554 455555555543 58899998889999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhCCCcEEEEeeccccCCChhhHhhcCC---CCCceEEEEecC
Q psy7151 112 LIKYVKETVGNMKVLVRKLGLDLGLTPEVVMRHPF---PGPGLAIRVICG 158 (188)
Q Consensus 112 iI~~IRe~Vg~~kVi~~~~GlSGGvDSavva~~~~---p~~~L~v~~~~~ 158 (188)
++++||++++++++++ |+|||+||+|++.++. ..+..++.++..
T Consensus 217 ~~~~ir~~v~~~~vvv---alSGGvDSsv~a~ll~~a~G~~v~av~v~~g 263 (525)
T 1gpm_A 217 AVARIREQVGDDKVIL---GLSGGVDSSVTAMLLHRAIGKNLTCVFVDNG 263 (525)
T ss_dssp HHHHHHHHHTTCEEEE---ECCSSHHHHHHHHHHHHHHGGGEEEEEEECS
T ss_pred hhhhhhhhhcccceEE---EecCCCCHHHHHHHHHHHhCCCEEEEEEeCC
Confidence 9999999999998888 9999999999994332 246777877654
|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* | Back alignment and structure |
|---|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* | Back alignment and structure |
|---|
| >1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A | Back alignment and structure |
|---|
| >4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* | Back alignment and structure |
|---|
| >3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} | Back alignment and structure |
|---|
| >2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A | Back alignment and structure |
|---|
| >3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* | Back alignment and structure |
|---|
| >1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B | Back alignment and structure |
|---|
| >1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* | Back alignment and structure |
|---|
| >2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A | Back alignment and structure |
|---|
| >1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* | Back alignment and structure |
|---|
| >3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A | Back alignment and structure |
|---|
| >2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A | Back alignment and structure |
|---|
| >2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* | Back alignment and structure |
|---|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* | Back alignment and structure |
|---|
| >1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* | Back alignment and structure |
|---|
| >1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 | Back alignment and structure |
|---|
| >1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* | Back alignment and structure |
|---|
| >3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* | Back alignment and structure |
|---|
| >2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 | Back alignment and structure |
|---|
| >2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 | Back alignment and structure |
|---|
| >2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 | Back alignment and structure |
|---|
| >1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 | Back alignment and structure |
|---|
| >1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 | Back alignment and structure |
|---|
| >1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A | Back alignment and structure |
|---|
| >2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 188 | ||||
| d1gpma2 | 205 | c.23.16.1 (A:3-207) GMP synthetase {Escherichia co | 8e-11 | |
| d1i7qb_ | 192 | c.23.16.1 (B:) Anthranilate synthase GAT subunit, | 6e-09 | |
| d1qdlb_ | 195 | c.23.16.1 (B:) Anthranilate synthase GAT subunit, | 1e-08 | |
| d1wl8a1 | 188 | c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA | 3e-08 | |
| d2a9va1 | 196 | c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA | 8e-08 | |
| d1a9xb2 | 228 | c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe | 2e-05 | |
| d1k9vf_ | 200 | c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i | 6e-04 | |
| d1jvna2 | 232 | c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain | 7e-04 | |
| d1gpma1 | 197 | c.26.2.1 (A:208-404) GMP synthetase, central domai | 7e-04 | |
| d1ka9h_ | 195 | c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i | 0.001 | |
| d1q7ra_ | 202 | c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus | 0.003 |
| >d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: Class I glutamine amidotransferases (GAT) domain: GMP synthetase species: Escherichia coli [TaxId: 562]
Score = 56.5 bits (135), Expect = 8e-11
Identities = 17/39 (43%), Positives = 23/39 (58%)
Query: 63 FHKDELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTG 101
+E R YG+QFHPEV T +G ML+ F+ D+C
Sbjct: 166 MANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEA 204
|
| >d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 | Back information, alignment and structure |
|---|
| >d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 | Back information, alignment and structure |
|---|
| >d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 188 | Back information, alignment and structure |
|---|
| >d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 | Back information, alignment and structure |
|---|
| >d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 | Back information, alignment and structure |
|---|
| >d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 | Back information, alignment and structure |
|---|
| >d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Length = 197 | Back information, alignment and structure |
|---|
| >d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 | Back information, alignment and structure |
|---|
| >d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| d1gpma2 | 205 | GMP synthetase {Escherichia coli [TaxId: 562]} | 99.6 | |
| d1i7qb_ | 192 | Anthranilate synthase GAT subunit, TrpG {Serratia | 99.59 | |
| d1qdlb_ | 195 | Anthranilate synthase GAT subunit, TrpG {Archaeon | 99.5 | |
| d1a9xb2 | 228 | Carbamoyl phosphate synthetase, small subunit C-te | 99.49 | |
| d1wl8a1 | 188 | GMP synthase subunit A, GuaAA {Archaeon Pyrococcus | 99.48 | |
| d2a9va1 | 196 | GMP synthase subunit A, GuaAA {Archaeon Thermoplas | 99.35 | |
| d1jvna2 | 232 | GAT subunit, HisH, (or domain) of imidazoleglycero | 98.99 | |
| d1wxia1 | 274 | NH3-dependent NAD+-synthetase {Escherichia coli [T | 98.98 | |
| d1kqpa_ | 271 | NH3-dependent NAD+-synthetase {Bacillus subtilis [ | 98.97 | |
| d1gpma1 | 197 | GMP synthetase, central domain {Escherichia coli [ | 98.94 | |
| d1ka9h_ | 195 | GAT subunit, HisH, (or domain) of imidazoleglycero | 98.74 | |
| d1l9xa_ | 288 | gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta | 98.71 | |
| d1xnga1 | 255 | NH3-dependent NAD+-synthetase {Helicobacter pylori | 98.68 | |
| d1k9vf_ | 200 | GAT subunit, HisH, (or domain) of imidazoleglycero | 98.55 | |
| d1q7ra_ | 202 | Hypothetical protein YaaE {Bacillus stearothermoph | 98.23 | |
| d2nv0a1 | 195 | Hypothetical protein YaaE {Bacillus subtilis [TaxI | 98.13 | |
| d2abwa1 | 218 | Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p | 97.92 | |
| d1o1ya_ | 230 | Hypothetical protein TM1158 {Thermotoga maritima [ | 97.86 | |
| d1vl2a1 | 168 | Argininosuccinate synthetase, N-terminal domain {T | 96.18 | |
| d1vcoa1 | 250 | CTP synthase PyrG, C-terminal domain {Thermus ther | 95.95 | |
| d1j20a1 | 165 | Argininosuccinate synthetase, N-terminal domain {T | 95.88 | |
| d1k92a1 | 188 | Argininosuccinate synthetase, N-terminal domain {E | 95.58 | |
| d1wy5a1 | 216 | TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId | 95.11 | |
| d1ni5a1 | 227 | tRNA-Ile-lysidine synthetase, TilS, N-terminal dom | 95.09 | |
| d1s1ma1 | 258 | CTP synthase PyrG, C-terminal domain {Escherichia | 95.09 | |
| d2c5sa1 | 218 | Thiamine biosynthesis protein ThiI, C-terminal dom | 94.7 | |
| d1zuna1 | 211 | Sulfate adenylyltransferase subunit 2, CysD {Pseud | 93.39 | |
| d1jgta1 | 299 | beta-Lactam synthetase {Streptomyces clavuligerus | 90.19 | |
| d1ct9a1 | 324 | Asparagine synthetase B, C-terminal domain {Escher | 89.31 | |
| d2pg3a1 | 230 | Queuosine biosynthesis protein QueC {Erwinia carot | 88.76 | |
| d1q15a1 | 296 | beta-Lactam synthetase {Pectobacterium carotovorum | 83.94 |
| >d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: Class I glutamine amidotransferases (GAT) domain: GMP synthetase species: Escherichia coli [TaxId: 562]
Probab=99.60 E-value=1.4e-16 Score=127.25 Aligned_cols=84 Identities=31% Similarity=0.489 Sum_probs=64.7
Q ss_pred eeecCCeEEecCcccCCcceeEEeeecccccccccccc-------ce------------------ec-----cccccccc
Q psy7151 16 GTLRPDLIESASHLASNKADVIKTHHNDSPLIRALREQ-------GK------------------VI-----EPLKDFHK 65 (188)
Q Consensus 16 g~~~g~~I~~~~~~~HGk~~~V~s~H~~~~Lf~~lp~~-------s~------------------vi-----~pi~Ai~~ 65 (188)
+.+||+.+.+++.+.||....+ .|....++.+++.. ++ +. .+.+++.+
T Consensus 91 a~~~Gg~v~~~~~~~~G~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~ 168 (205)
T d1gpma2 91 AMQLGGHVEASNEREFGYAQVE--VVNDSALVRGIEDALTADGKPLLDVWMSHGDKVTAIPSDFITVASTESCPFAIMAN 168 (205)
T ss_dssp HHHHTCEEECCSSCEEEEEEEE--ECSCCTTTTTCCSEECTTSCEEEEEEEEECSEEEECCTTCEEEEECSSCSCSEEEE
T ss_pred hhhcCCccccccccccCcceec--cccccccccccccccccCCccceeeecccccccccccccceeeeccCCCceEEEEe
Confidence 4578999999999999987766 45555555544311 11 00 12566777
Q ss_pred ccccEEEEeecccccCChhhHHHHHHHHHHhhCCCC
Q psy7151 66 DELRLYGLQFHPEVDLTNEGRTMLKNFLFDVCGLTG 101 (188)
Q Consensus 66 ~~~~i~GVQFHPE~~~t~~G~~il~nFl~~i~~~~~ 101 (188)
.++++||||||||+++|++|.+||+||+..||+|++
T Consensus 169 ~~~ni~gvQFHPE~s~s~~G~~il~nFl~~i~~~~~ 204 (205)
T d1gpma2 169 EEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEA 204 (205)
T ss_dssp TTTTEEEESBCTTSTTSTTHHHHHHHHHHTTSCCCC
T ss_pred CCCCEEEEEeecccCCCccHHHHHHHHHHHHhCCcc
Confidence 788999999999999999999999999999999985
|
| >d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|