Diaphorina citri psyllid: psy7163


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
GNSKYHYYGIRVKPDSPLNNIPLSDENGGNSKYHYYGIRVKPDSPLNNIPLSDENGSPRGKKYKLVKTDSNSNQYGSEGHTTAGQTNSNPSPQSGNHNFLGDGSNAIPDFPEIDLSEDCLPEDCTIEDVDTFRSIYREHCEAFLDAIVTLDFSTIESLWREFWRSQDNNNGDECEEEKYLSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDAFLDAIVTLDFSTIESLWREFWRSQDNNNGDECEEEKYLSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDVLRPIPGSLTSSIRNFAKGVESWLTNAMQGCPQEMINIKVTAVGAFAQMLRRYTSLNHLAQAARAVLQNSTQINQMLTDLNRVDFHNVQEQASWVCQCDASLVQQLESDFKLTLQQQNSLEEWANWLKNVVNAVLKPFEGKPNFTKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLIEHQVALATGETPIAVIGSKESNPVESSQNPMDNGLYAHGQNNILVHEELHISHAPKRIKLS
cccccEEEEEEEccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHcccccccccccccHHcccccHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHcccccccccccHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**SKYHYYGIRVKPDS***************KYHYYGIRVK*******************************************************************DFPEIDLSEDCLPEDCTIEDVDTFRSIYREHCEAFLDAIVTLDFSTIESLWREFWRSQ*************LSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDAFLDAIVTLDFSTIESLWREFWRSQD***********YLSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDVLRPIPGSLTSSIRNFAKGVESWLTNAMQGCPQEMINIKVTAVGAFAQMLRRYTSLNHLAQAARAVLQNSTQINQMLTDLNRVDFHNVQEQASWVCQCDASLVQQLESDFKLTLQQQNSLEEWANWLKNVVNAVLKPFEGKPNFTKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLIEHQVALATGETPIAVI*********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GNSKYHYYGIRVKPDSPLNNIPLSDENGGNSKYHYYGIRVKPDSPLNNIPLSDENGSPRGKKYKLVKTDSNSNQYGSEGHTTAGQTNSNPSPQSGNHNFLGDGSNAIPDFPEIDLSEDCLPEDCTIEDVDTFRSIYREHCEAFLDAIVTLDFSTIESLWREFWRSQDNNNGDECEEEKYLSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDAFLDAIVTLDFSTIESLWREFWRSQDNNNGDECEEEKYLSKSKLFCLSKCVPVQAFVRRVDFLFYQNLVEVLIPDVLRPIPGSLTSSIRNFAKGVESWLTNAMQGCPQEMINIKVTAVGAFAQMLRRYTSLNHLAQAARAVLQNSTQINQMLTDLNRVDFHNVQEQASWVCQCDASLVQQLESDFKLTLQQQNSLEEWANWLKNVVNAVLKPFEGKPNFTKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLIEHQVALATGETPIAVIGSKESNPVESSQNPMDNGLYAHGQNNILVHEELHISHAPKRIKLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor RFX3 Transcription factor required for ciliogenesis and islet cell differentiation during endocrine pancreas development. Essential for the differentiation of nodal monocilia and left-right asymmetry specification during embryogenesis. Required for the biogenesis of motile cilia by governing growth and beating efficiency of motile cells. Also required for ciliated ependymal cell differentiation. Regulates the expression of genes involved in ciliary assembly (DYNC2LI1, FOXJ1 and BBS4) and genes involved in ciliary motility (DNAH11, DNAH9 and DNAH5) (By similarity). Together with RFX6, participates in the differentiation of 4 of the 5 islet cell types during endocrine pancreas development, with the exception of pancreatic PP (polypeptide-producing) cells. Regulates transcription by forming a heterodimer with another RFX protein and binding to the X-box in the promoter of target genes. Acts as a transcription factor. Represses transcription of MAP1A in non-neuronal cells but not in neuronal cells.confidentP48380
Transcription factor RFX3 Transcription factor required for ciliogenesis and islet cell differentiation during endocrine pancreas development.confidentQ0V9K5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0048858 [BP]cell projection morphogenesisprobableGO:0032502, GO:0048856, GO:0000902, GO:0030030, GO:0048869, GO:0009987, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699, GO:0032990
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DP7, chain P
Confidence level:probable
Coverage over the Query: 22-42
View the alignment between query and template
View the model in PyMOL