Diaphorina citri psyllid: psy7191

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MDNSVLPGPSSTQFGLEEHMSLDFAEYLRELTRAQFVSNNKFTIEEEETLKKNLASLKRLSEDIYNKKYPRTFQTSASGLNDSSDDVTMIDMTYGDGNHTRLILENIGNVKVICLDRDKESFEKAKTLAANDPRLVPVYGKFSDLPNILKNMNNNFNSIDGIIMDVGISDSQANSTRGFKPDSNSLLDMRMSQEGITGYQVLSAIDEVSLAKILKTYGEEKRSRQIARAIIETRYTFKKLERTRDLNELVASVSRPSQTWKRACRTESLQWIATASVVGTEVRVDPRKHGSEHVAQKVYNGLRRFVNNELNELNYAMIIAEKYLKPEGLLLTKCNSIVEDKIVKRHLTGNVIEHCANDLALKFVNHNLTVNPLDMSSLTSSPWTILDKIIPSDSDLKLRVAMKKESNKANVSQ
cccccccccccccccHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHcccccccHHHHHccccccccccEEEECccccccHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccEEEEccccccHHHHHHHcccccccccEEEEEccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHEEEcccccccccc
**********STQFGLEEHMSLDFAEYLRELTRAQFVSNNKFTIE******************IYNKKYPRTFQTSASGLNDSSDDVTMIDMTYGDGNHTRLILENIGNVKVICLDRDKESFEKAKTLAANDPRLVPVYGKFSDLPNILKNMNNNFNSIDGIIMDVGISDSQANSTRGFKPDSNSLLDMRMSQEGITGYQVLSAIDEVSLAKILKTYGEEKRSRQIARAIIETRYTFKKLERTRDLNELVASVSRPSQTWKRACRTESLQWIATASVVGTEVRVDPRKHGSEHVAQKVYNGLRRFVNNELNELNYAMIIAEKYLKPEGLLLTKCNSIVEDKIVKRHLTGNVIEHCANDLALKFVNHNLTVNPLDMSSLTSSPWTILDKIIPSDSDLKLRV*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNSVLPGPSSTQFGLEEHMSLDFAEYLRELTRAQFVSNNKFTIEEEETLKKNLASLKRLSEDIYNKKYPRTFQTSASGLNDSSDDVTMIDMTYGDGNHTRLILENIGNVKVICLDRDKESFEKAKTLAANDPRLVPVYGKFSDLPNILKNMNNNFNSIDGIIMDVGISDSQANSTRGFKPDSNSLLDMRMSQEGITGYQVLSAIDEVSLAKILKTYGEEKRSRQIARAIIETRYTFKKLERTRDLNELVASVSRPSQTWKRACRTESLQWIATASVVGTEVRVDPRKHGSEHVAQKVYNGLRRFVNNELNELNYAMIIAEKYLKPEGLLLTKCNSIVEDKIVKRHLTGNVIEHCANDLALKFVNHNLTVNPLDMSSLTSSPWTILDKIIPSDSDLKLRVAMKKESNKANVSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable methyltransferase-like protein 15 homolog Probable S-adenosyl-L-methionine-dependent methyltransferase.confidentQ9VGY5

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TKA, chain A
Confidence level:very confident
Coverage over the Query: 69-256,292-352,380-404
View the alignment between query and template
View the model in PyMOL
Template: 3LKZ, chain A
Confidence level:probable
Coverage over the Query: 21-171
View the alignment between query and template
View the model in PyMOL