Diaphorina citri psyllid: psy7197

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49

MYHSLPLCSQSWYDYKLTWDPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWKPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHLDEEKGTNVVDIGVDLTAFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLNIHFRSPQTHVMSPWVKKVFIHLLPKLLVMRRPQYDRNKRDMDPSQHQSTCKVHGTPTRPPGDLPLDDIESEPLDPLPPPIPPLPPMKKVSHHWHLCPELHKAIAGVRFIADHTKTAVNDTKVKPLEVERSLCHGWDYNSPLIIPSPAMVLDRLFLWIFTLAVLIGSAGIILQAPTLYDDRVPIDVRISEIASTTAKPVIASTL

ccccccEEEEEEECccccccccccccccEEECcccccccccEEEEEcccccccccEEEEEEEEcccEEEECcccEEEECcCEEcEEEcccccCEEEEECcccccccEEEEEEccccccccEEEEEcccccccccccEEEEEccCEEEEEEccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEEECccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccc

MYHSLPLCSQSWYDYKLTWDPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWKPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHLDEEKGTNVVDIGVDLTAFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLNIHFRSPQTHVMSPWVKKVFIHLLPKLLVMRRPQ*************************PPGDLPLDDIESE***************KKVSHHWHLCPELHKAIAGVRFIADHTKTAVNDTKVKPLEVERSLCHGWDYNSPLIIPSPAMVLDRLFLWIFTLAVLIGSAGIILQAPTLYDDRVPIDVRISEIA*****P******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Neuronal acetylcholine receptor subunit alpha-3	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.	confident	P04757
Neuronal acetylcholine receptor subunit alpha-3	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.	confident	Q8R4G9
Neuronal acetylcholine receptor subunit alpha-3	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.	confident	P32297

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005892 [CC]	acetylcholine-gated channel complex	probable	GO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0034702, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0015464 [MF]	acetylcholine receptor activity	probable	GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0006281 [BP]	DNA repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0051291 [BP]	protein heterooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008144 [MF]	drug binding	probable	GO:0003674, GO:0005488
GO:0009897 [CC]	external side of plasma membrane	probable	GO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0010646 [BP]	regulation of cell communication	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0035094 [BP]	response to nicotine	probable	GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0006979 [BP]	response to oxidative stress	probable	GO:0006950, GO:0008150, GO:0050896
GO:0007274 [BP]	neuromuscular synaptic transmission	probable	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0023051 [BP]	regulation of signaling	probable	GO:0008150, GO:0065007, GO:0050789
GO:0050890 [BP]	cognition	probable	GO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0042166 [MF]	acetylcholine binding	probable	GO:0043169, GO:0042165, GO:0043167, GO:0003674, GO:0050997, GO:0005488
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044708 [BP]	single-organism behavior	probable	GO:0050896, GO:0008150, GO:0007610
GO:0006811 [BP]	ion transport	probable	GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0004889 [MF]	acetylcholine-activated cation-selective channel activity	probable	GO:0022891, GO:0008324, GO:0005261, GO:0022892, GO:0005215, GO:0005230, GO:0005231, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BG9, chain B
Confidence level:very confident
Coverage over the Query: 2-216,245-295,387-468
View the alignment between query and template
View the model in PyMOL

Template: 4AQ5, chain B
Confidence level:very confident
Coverage over the Query: 2-216,245-303
View the alignment between query and template
View the model in PyMOL

Template: 3TLW, chain A
Confidence level:confident
Coverage over the Query: 221-252
View the alignment between query and template
View the model in PyMOL