Diaphorina citri psyllid: psy719


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40-----
MGSTIRKRKLYEEFLSRVSILVQCGSKKMGIVAKHVTCAMVEKGE
ccHHHHHHHHHHHHHHHHHEEEEEccEEEEEEEEEEEEEEEEccc
******K*KLYEEFLSRVSILVQCGSKKMGIVAKHVTCAMVEK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTIRKRKLYEEFLSRVSILVQCGSKKMGIVAKHVTCAMVEKGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cAMP-dependent protein kinase type I-beta regulatory subunit Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.confidentP12849
cAMP-dependent protein kinase type I-beta regulatory subunit Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.confidentP31321

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0005952 [CC]cAMP-dependent protein kinase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488
GO:0008603 [MF]cAMP-dependent protein kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DIN, chain B
Confidence level:very confident
Coverage over the Query: 4-45
View the alignment between query and template
View the model in PyMOL