Diaphorina citri psyllid: psy7201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL
cccccccccccccEECccCEcccccEEEEEECcccccccCEEEEEEEEEECcccccccccccccc
*****NKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEF**********I**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicular integral-membrane protein VIP36 Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.confidentQ12907
Vesicular integral-membrane protein VIP36 Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.confidentP49256
Vesicular integral-membrane protein VIP36 Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.confidentQ9DBH5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005793 [CC]endoplasmic reticulum-Golgi intermediate compartmentprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GV9, chain A
Confidence level:very confident
Coverage over the Query: 7-52
View the alignment between query and template
View the model in PyMOL