Psyllid ID: psy7201


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL
cccccccccccccEEEccEEcccccEEEEEEEcccccccEEEEEEEEEEEEcccccccccccccc
ccccccccccHHEEEccccEcccccEEEEEEccccccccccEEEEEEEEcccccccccccccccc
STDFENKAAWKECFKvsgvklptgyyfgvsaatgdlsdnhdvlgirtyelefpgeklskgpfinl
stdfenkaaWKECFKVSGVKLPTGYYFGVSaatgdlsdnHDVLGIRTYelefpgeklskgpfinl
STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL
*******AAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEF*************
**DFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTY**************I**
********AWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL
*****NKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFP************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLSKGPFINL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query65 2.2.26 [Sep-21-2011]
Q9DBH5358 Vesicular integral-membra yes N/A 0.753 0.136 0.612 1e-13
P49256356 Vesicular integral-membra yes N/A 0.753 0.137 0.591 1e-13
Q12907356 Vesicular integral-membra yes N/A 0.753 0.137 0.591 2e-13
Q2HJD1348 VIP36-like protein OS=Bos no N/A 0.738 0.137 0.562 3e-12
Q5RCF0348 VIP36-like protein OS=Pon no N/A 0.738 0.137 0.562 3e-12
Q9H0V9348 VIP36-like protein OS=Hom no N/A 0.738 0.137 0.562 4e-12
P59481347 VIP36-like protein OS=Mus no N/A 0.738 0.138 0.541 1e-11
Q62902 517 Protein ERGIC-53 OS=Rattu no N/A 0.784 0.098 0.450 1e-06
Q9D0F3 517 Protein ERGIC-53 OS=Mus m no N/A 0.784 0.098 0.450 1e-06
Q9TU32 510 Protein ERGIC-53 OS=Chlor N/A N/A 0.784 0.1 0.450 3e-06
>sp|Q9DBH5|LMAN2_MOUSE Vesicular integral-membrane protein VIP36 OS=Mus musculus GN=Lman2 PE=2 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (79%)

Query: 2   TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYEL 50
           TD E+K  WK C  ++GV+LPTGYYFG SA TGDLSDNHD++ I+ ++L
Sbjct: 230 TDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQL 278




Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Mus musculus (taxid: 10090)
>sp|P49256|LMAN2_CANFA Vesicular integral-membrane protein VIP36 OS=Canis familiaris GN=LMAN2 PE=1 SV=1 Back     alignment and function description
>sp|Q12907|LMAN2_HUMAN Vesicular integral-membrane protein VIP36 OS=Homo sapiens GN=LMAN2 PE=1 SV=1 Back     alignment and function description
>sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 Back     alignment and function description
>sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 Back     alignment and function description
>sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 Back     alignment and function description
>sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=2 SV=1 Back     alignment and function description
>sp|Q62902|LMAN1_RAT Protein ERGIC-53 OS=Rattus norvegicus GN=Lman1 PE=1 SV=1 Back     alignment and function description
>sp|Q9D0F3|LMAN1_MOUSE Protein ERGIC-53 OS=Mus musculus GN=Lman1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TU32|LMAN1_CHLAE Protein ERGIC-53 OS=Chlorocebus aethiops GN=LMAN1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
383866233 324 PREDICTED: vesicular integral-membrane p 0.846 0.169 0.745 6e-19
340725431 323 PREDICTED: VIP36-like protein-like [Bomb 0.815 0.164 0.754 8e-19
350403942 323 PREDICTED: vesicular integral-membrane p 0.846 0.170 0.727 1e-18
66525147 324 PREDICTED: vesicular integral-membrane p 0.846 0.169 0.727 2e-18
380016416 324 PREDICTED: vesicular integral-membrane p 0.846 0.169 0.709 4e-18
91090624 324 PREDICTED: similar to vesicular mannose- 0.846 0.169 0.709 7e-18
157126608 338 vesicular mannose-binding lectin [Aedes 0.830 0.159 0.759 1e-17
242018971 329 Vesicular integral-membrane protein VIP3 0.815 0.161 0.735 2e-17
322801014 332 hypothetical protein SINV_09590 [Solenop 0.846 0.165 0.690 2e-17
347971840 335 AGAP004407-PA [Anopheles gambiae str. PE 0.8 0.155 0.75 4e-17
>gi|383866233|ref|XP_003708575.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 98.2 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/55 (74%), Positives = 46/55 (83%)

Query: 1   STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGE 55
           STDF NKAAWKECF V  +KLPTGYYFGVSA TGDLSDNHD+L IR +EL+ P +
Sbjct: 199 STDFANKAAWKECFSVKDIKLPTGYYFGVSATTGDLSDNHDILSIRLFELDLPDD 253




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340725431|ref|XP_003401073.1| PREDICTED: VIP36-like protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403942|ref|XP_003486958.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66525147|ref|XP_625194.1| PREDICTED: vesicular integral-membrane protein VIP36 [Apis mellifera] Back     alignment and taxonomy information
>gi|380016416|ref|XP_003692181.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Apis florea] Back     alignment and taxonomy information
>gi|91090624|ref|XP_973445.1| PREDICTED: similar to vesicular mannose-binding lectin [Tribolium castaneum] gi|270013907|gb|EFA10355.1| hypothetical protein TcasGA2_TC012578 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157126608|ref|XP_001654670.1| vesicular mannose-binding lectin [Aedes aegypti] gi|108873193|gb|EAT37418.1| AAEL010584-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242018971|ref|XP_002429942.1| Vesicular integral-membrane protein VIP36 precursor, putative [Pediculus humanus corporis] gi|212514988|gb|EEB17204.1| Vesicular integral-membrane protein VIP36 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322801014|gb|EFZ21795.1| hypothetical protein SINV_09590 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|347971840|ref|XP_313693.4| AGAP004407-PA [Anopheles gambiae str. PEST] gi|333469053|gb|EAA09126.4| AGAP004407-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
UNIPROTKB|D6RDX1288 LMAN2 "Vesicular integral-memb 0.753 0.170 0.591 4.7e-14
MGI|MGI:1914140358 Lman2 "lectin, mannose-binding 0.753 0.136 0.612 5.9e-14
RGD|1308965358 Lman2 "lectin, mannose-binding 0.753 0.136 0.632 7.6e-14
UNIPROTKB|D6RBV2325 LMAN2 "Vesicular integral-memb 0.753 0.150 0.591 8.9e-14
FB|FBgn0039160329 CG5510 [Drosophila melanogaste 0.784 0.155 0.607 9.4e-14
UNIPROTKB|P49256356 LMAN2 "Vesicular integral-memb 0.753 0.137 0.591 1.2e-13
UNIPROTKB|Q12907356 LMAN2 "Vesicular integral-memb 0.753 0.137 0.591 1.2e-13
UNIPROTKB|A6QP36359 LMAN2 "LMAN2 protein" [Bos tau 0.753 0.136 0.591 1.3e-13
UNIPROTKB|F1S3D5359 LMAN2 "Uncharacterized protein 0.753 0.136 0.591 1.3e-13
UNIPROTKB|J9P396384 LMAN2 "Vesicular integral-memb 0.753 0.127 0.591 1.6e-13
UNIPROTKB|D6RDX1 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 182 (69.1 bits), Expect = 4.7e-14, P = 4.7e-14
 Identities = 29/49 (59%), Positives = 39/49 (79%)

Query:     2 TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYEL 50
             TD E+K  WK C  ++GV+LPTGYYFG SA TGDLSDNHD++ ++ ++L
Sbjct:   221 TDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQL 269




GO:0016020 "membrane" evidence=IEA
MGI|MGI:1914140 Lman2 "lectin, mannose-binding 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308965 Lman2 "lectin, mannose-binding 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBV2 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0039160 CG5510 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P49256 LMAN2 "Vesicular integral-membrane protein VIP36" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q12907 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QP36 LMAN2 "LMAN2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3D5 LMAN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P396 LMAN2 "Vesicular integral-membrane protein VIP36" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P49256LMAN2_CANFANo assigned EC number0.59180.75380.1376yesN/A
Q12907LMAN2_HUMANNo assigned EC number0.59180.75380.1376yesN/A
Q9DBH5LMAN2_MOUSENo assigned EC number0.61220.75380.1368yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
cd06901248 cd06901, lectin_VIP36_VIPL, VIP36 and VIPL type 1 1e-24
pfam03388226 pfam03388, Lectin_leg-like, Legume-like lectin fam 7e-18
cd07308218 cd07308, lectin_leg-like, legume-like lectins: ERG 3e-15
cd06902225 cd06902, lectin_ERGIC-53_ERGL, ERGIC-53 and ERGL t 9e-12
cd01951223 cd01951, lectin_L-type, legume lectins 2e-04
>gnl|CDD|173889 cd06901, lectin_VIP36_VIPL, VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
 Score = 90.9 bits (226), Expect = 1e-24
 Identities = 34/53 (64%), Positives = 42/53 (79%)

Query: 1   STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFP 53
            TD + K  WKECF V+GV+LPTGYYFG SAATGDLSDNHD++ ++ YEL+  
Sbjct: 174 MTDIDGKNEWKECFDVTGVRLPTGYYFGASAATGDLSDNHDIISMKLYELDVE 226


The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER). Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 248

>gnl|CDD|217528 pfam03388, Lectin_leg-like, Legume-like lectin family Back     alignment and domain information
>gnl|CDD|173892 cd07308, lectin_leg-like, legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>gnl|CDD|173890 cd06902, lectin_ERGIC-53_ERGL, ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 99.83
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 99.76
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 99.73
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 99.69
KOG3839|consensus351 99.64
KOG3838|consensus 497 99.61
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.56
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 98.01
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 97.64
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 96.8
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 92.69
PF09116112 gp45-slide_C: gp45 sliding clamp, C terminal; Inte 86.01
PHA02545223 45 sliding clamp; Provisional 82.92
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
Probab=99.83  E-value=6.3e-21  Score=134.95  Aligned_cols=57  Identities=60%  Similarity=1.120  Sum_probs=53.8

Q ss_pred             cccccccccccceeecceecCCCCeEEEeecCCCCCCCeeeEEEEEeeecCCCCcCC
Q psy7201           2 TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLS   58 (65)
Q Consensus         2 ~di~~~~~w~~Cf~~~~v~LP~~~yfGiSAaTG~lsDnhDIis~~~~~l~~~~~~~~   58 (65)
                      +|++++++|+.||++++|.||+++||||||+||+++|+|||++|++|++..+.++++
T Consensus       175 vd~~~~~~w~~Cf~~~~v~LP~~~yfGiSA~Tg~~sd~hdIlsv~~~~l~~~~~~~~  231 (248)
T cd06901         175 TDIDGKNEWKECFDVTGVRLPTGYYFGASAATGDLSDNHDIISMKLYELDVEETPEE  231 (248)
T ss_pred             EecCCCCceeeeEEeCCeecCCCCEEEEEecCCCCCCcEEEEEEEEecCcccccccc
Confidence            678899999999999999999999999999999999999999999999999988743



The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER). Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded she

>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>KOG3839|consensus Back     alignment and domain information
>KOG3838|consensus Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>PF09116 gp45-slide_C: gp45 sliding clamp, C terminal; InterPro: IPR015200 This domain is essential for the interaction of the gp45 sliding clamp with the corresponding polymerase Back     alignment and domain information
>PHA02545 45 sliding clamp; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
2duo_A253 Crystal Structure Of Vip36 ExoplasmicLUMENAL DOMAIN 2e-14
1r1z_A263 The Crystal Structure Of The Carbohydrate Recogniti 3e-07
1gv9_A260 P58ERGIC-53 Length = 260 3e-07
3a4u_A255 Crystal Structure Of Mcfd2 In Complex With Carbohyd 1e-06
3lcp_A247 Crystal Structure Of The Carbohydrate Recognition D 1e-06
>pdb|2DUO|A Chain A, Crystal Structure Of Vip36 ExoplasmicLUMENAL DOMAIN, CA2+- Bound Form Length = 253 Back     alignment and structure

Iteration: 1

Score = 74.3 bits (181), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 39/49 (79%) Query: 2 TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYEL 50 TD E+K WK C ++GV+LPTGYYFG SA TGDLSDNHD++ ++ ++L Sbjct: 180 TDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQL 228
>pdb|1R1Z|A Chain A, The Crystal Structure Of The Carbohydrate Recognition Domain Of The Glycoprotein Sorting Receptor P58ERGIC-53 Reveals A Novel Metal Binding Site And Conformational Changes Associated With Calcium Ion Binding Length = 263 Back     alignment and structure
>pdb|1GV9|A Chain A, P58ERGIC-53 Length = 260 Back     alignment and structure
>pdb|3A4U|A Chain A, Crystal Structure Of Mcfd2 In Complex With Carbohydrate Recognition Domain Of Ergic-53 Length = 255 Back     alignment and structure
>pdb|3LCP|A Chain A, Crystal Structure Of The Carbohydrate Recognition Domain Of Complex With Mcfd2 Length = 247 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 8e-17
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 5e-16
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 4e-15
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 4e-15
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 1e-12
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
 Score = 70.3 bits (171), Expect = 8e-17
 Identities = 23/52 (44%), Positives = 36/52 (69%)

Query: 5   ENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEK 56
            +K  ++ C KV  + +PT  +FG+SAATG L+D+HDVL   T++L  PG++
Sbjct: 206 PDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTEPGKE 257


>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Length = 226 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Length = 222 Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Length = 256 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 99.71
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 99.55
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.55
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.54
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.43
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 98.25
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 98.19
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 97.82
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 97.82
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 97.79
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 97.78
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 97.77
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 97.77
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 97.71
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 97.67
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 97.66
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 97.64
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 97.63
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 97.6
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 97.45
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 97.42
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 97.42
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 97.36
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 97.31
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 97.13
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 97.11
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 97.04
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 97.01
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 96.9
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 96.65
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 96.11
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
Probab=99.71  E-value=5.2e-18  Score=117.94  Aligned_cols=50  Identities=20%  Similarity=0.400  Sum_probs=44.9

Q ss_pred             cccccccccccceeecceecCCCC--eEEEeecCCCCCCCeeeEEEEEeeecCCCC
Q psy7201           2 TDFENKAAWKECFKVSGVKLPTGY--YFGVSAATGDLSDNHDVLGIRTYELEFPGE   55 (65)
Q Consensus         2 ~di~~~~~w~~Cf~~~~v~LP~~~--yfGiSAaTG~lsDnhDIis~~~~~l~~~~~   55 (65)
                      |++|+    +.||++++|.||.++  ||||||+||+++|+|||++|++|++..+++
T Consensus       174 v~id~----~~Cf~~~~v~LP~g~~~yfGiSAaTg~~~D~hdils~~~~~~~~~~~  225 (226)
T 2a6v_A          174 LQMDN----RVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDGVIEDS  225 (226)
T ss_dssp             EEETT----EEEEEESCCCGGGTSCBEEEEEEECCTTCCEEEEEEEEEESSCCC--
T ss_pred             EEEcC----CeeEEECCeecCCCCccEEEEEEcCCCCcccEEEEEEEEEecccccc
Confidence            56665    899999999999999  999999999999999999999999987753



>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 65
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 8e-16
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 1e-14
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 2e-13
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 1e-06
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 2e-06
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 4e-06
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 5e-05
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-04
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-04
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 2e-04
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 4e-04
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 4e-04
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 5e-04
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 0.001
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 0.001
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 0.002
d1nlsa_ 237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 0.002
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Lectin leg-like
domain: Emp46p N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 65.8 bits (160), Expect = 8e-16
 Identities = 9/52 (17%), Positives = 22/52 (42%), Gaps = 2/52 (3%)

Query: 1   STDFENKAAWKECFKVSGVKLPTG--YYFGVSAATGDLSDNHDVLGIRTYEL 50
           +   + +   + CF+   VK      +  G SA      ++ ++L ++ Y+ 
Sbjct: 164 NHLLKLQMDNRVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDG 215


>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.55
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.32
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.29
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 98.54
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 98.42
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 98.36
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 98.34
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 98.31
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 98.16
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 98.13
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 98.06
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 98.02
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 97.97
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 97.91
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 97.74
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 97.57
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 97.36
d1nlsa_ 237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 97.1
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 96.85
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 96.83
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 96.83
d1leda_243 Legume lectin {West-central african legume (Griffo 96.68
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 96.35
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 96.17
d1b77a2118 gp45 sliding clamp {Bacteriophage RB69 [TaxId: 123 81.76
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Lectin leg-like
domain: Emp46p N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.55  E-value=1.2e-15  Score=102.00  Aligned_cols=44  Identities=20%  Similarity=0.421  Sum_probs=40.4

Q ss_pred             ccccceeecceecCCC--CeEEEeecCCCCCCCeeeEEEEEeeecC
Q psy7201           9 AWKECFKVSGVKLPTG--YYFGVSAATGDLSDNHDVLGIRTYELEF   52 (65)
Q Consensus         9 ~w~~Cf~~~~v~LP~~--~yfGiSAaTG~lsDnhDIis~~~~~l~~   52 (65)
                      +|+.||++.+|.||.+  +||||||+||+++|+|||++|++|+..+
T Consensus       172 d~~~c~~t~~i~lp~~~~~yfG~SA~Tg~~~d~~dIls~~~~~~~~  217 (218)
T d2a6va1         172 DNRVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDGVI  217 (218)
T ss_dssp             TTEEEEEESCCCGGGTSCBEEEEEEECCTTCCEEEEEEEEEESSCC
T ss_pred             CCcEEEEECCeecCCCCcEEEEEEECCCCCcCcEEEEEEEEEeccc
Confidence            3699999999999986  6899999999999999999999998765



>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1b77a2 d.131.1.2 (A:111-228) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure