Psyllid ID: psy7201
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| 383866233 | 324 | PREDICTED: vesicular integral-membrane p | 0.846 | 0.169 | 0.745 | 6e-19 | |
| 340725431 | 323 | PREDICTED: VIP36-like protein-like [Bomb | 0.815 | 0.164 | 0.754 | 8e-19 | |
| 350403942 | 323 | PREDICTED: vesicular integral-membrane p | 0.846 | 0.170 | 0.727 | 1e-18 | |
| 66525147 | 324 | PREDICTED: vesicular integral-membrane p | 0.846 | 0.169 | 0.727 | 2e-18 | |
| 380016416 | 324 | PREDICTED: vesicular integral-membrane p | 0.846 | 0.169 | 0.709 | 4e-18 | |
| 91090624 | 324 | PREDICTED: similar to vesicular mannose- | 0.846 | 0.169 | 0.709 | 7e-18 | |
| 157126608 | 338 | vesicular mannose-binding lectin [Aedes | 0.830 | 0.159 | 0.759 | 1e-17 | |
| 242018971 | 329 | Vesicular integral-membrane protein VIP3 | 0.815 | 0.161 | 0.735 | 2e-17 | |
| 322801014 | 332 | hypothetical protein SINV_09590 [Solenop | 0.846 | 0.165 | 0.690 | 2e-17 | |
| 347971840 | 335 | AGAP004407-PA [Anopheles gambiae str. PE | 0.8 | 0.155 | 0.75 | 4e-17 |
| >gi|383866233|ref|XP_003708575.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 98.2 bits (243), Expect = 6e-19, Method: Composition-based stats.
Identities = 41/55 (74%), Positives = 46/55 (83%)
Query: 1 STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGE 55
STDF NKAAWKECF V +KLPTGYYFGVSA TGDLSDNHD+L IR +EL+ P +
Sbjct: 199 STDFANKAAWKECFSVKDIKLPTGYYFGVSATTGDLSDNHDILSIRLFELDLPDD 253
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340725431|ref|XP_003401073.1| PREDICTED: VIP36-like protein-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350403942|ref|XP_003486958.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|66525147|ref|XP_625194.1| PREDICTED: vesicular integral-membrane protein VIP36 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016416|ref|XP_003692181.1| PREDICTED: vesicular integral-membrane protein VIP36-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|91090624|ref|XP_973445.1| PREDICTED: similar to vesicular mannose-binding lectin [Tribolium castaneum] gi|270013907|gb|EFA10355.1| hypothetical protein TcasGA2_TC012578 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157126608|ref|XP_001654670.1| vesicular mannose-binding lectin [Aedes aegypti] gi|108873193|gb|EAT37418.1| AAEL010584-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|242018971|ref|XP_002429942.1| Vesicular integral-membrane protein VIP36 precursor, putative [Pediculus humanus corporis] gi|212514988|gb|EEB17204.1| Vesicular integral-membrane protein VIP36 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|322801014|gb|EFZ21795.1| hypothetical protein SINV_09590 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|347971840|ref|XP_313693.4| AGAP004407-PA [Anopheles gambiae str. PEST] gi|333469053|gb|EAA09126.4| AGAP004407-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| UNIPROTKB|D6RDX1 | 288 | LMAN2 "Vesicular integral-memb | 0.753 | 0.170 | 0.591 | 4.7e-14 | |
| MGI|MGI:1914140 | 358 | Lman2 "lectin, mannose-binding | 0.753 | 0.136 | 0.612 | 5.9e-14 | |
| RGD|1308965 | 358 | Lman2 "lectin, mannose-binding | 0.753 | 0.136 | 0.632 | 7.6e-14 | |
| UNIPROTKB|D6RBV2 | 325 | LMAN2 "Vesicular integral-memb | 0.753 | 0.150 | 0.591 | 8.9e-14 | |
| FB|FBgn0039160 | 329 | CG5510 [Drosophila melanogaste | 0.784 | 0.155 | 0.607 | 9.4e-14 | |
| UNIPROTKB|P49256 | 356 | LMAN2 "Vesicular integral-memb | 0.753 | 0.137 | 0.591 | 1.2e-13 | |
| UNIPROTKB|Q12907 | 356 | LMAN2 "Vesicular integral-memb | 0.753 | 0.137 | 0.591 | 1.2e-13 | |
| UNIPROTKB|A6QP36 | 359 | LMAN2 "LMAN2 protein" [Bos tau | 0.753 | 0.136 | 0.591 | 1.3e-13 | |
| UNIPROTKB|F1S3D5 | 359 | LMAN2 "Uncharacterized protein | 0.753 | 0.136 | 0.591 | 1.3e-13 | |
| UNIPROTKB|J9P396 | 384 | LMAN2 "Vesicular integral-memb | 0.753 | 0.127 | 0.591 | 1.6e-13 |
| UNIPROTKB|D6RDX1 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 182 (69.1 bits), Expect = 4.7e-14, P = 4.7e-14
Identities = 29/49 (59%), Positives = 39/49 (79%)
Query: 2 TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYEL 50
TD E+K WK C ++GV+LPTGYYFG SA TGDLSDNHD++ ++ ++L
Sbjct: 221 TDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQL 269
|
|
| MGI|MGI:1914140 Lman2 "lectin, mannose-binding 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308965 Lman2 "lectin, mannose-binding 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RBV2 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039160 CG5510 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49256 LMAN2 "Vesicular integral-membrane protein VIP36" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q12907 LMAN2 "Vesicular integral-membrane protein VIP36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QP36 LMAN2 "LMAN2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3D5 LMAN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P396 LMAN2 "Vesicular integral-membrane protein VIP36" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| cd06901 | 248 | cd06901, lectin_VIP36_VIPL, VIP36 and VIPL type 1 | 1e-24 | |
| pfam03388 | 226 | pfam03388, Lectin_leg-like, Legume-like lectin fam | 7e-18 | |
| cd07308 | 218 | cd07308, lectin_leg-like, legume-like lectins: ERG | 3e-15 | |
| cd06902 | 225 | cd06902, lectin_ERGIC-53_ERGL, ERGIC-53 and ERGL t | 9e-12 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 2e-04 |
| >gnl|CDD|173889 cd06901, lectin_VIP36_VIPL, VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
Score = 90.9 bits (226), Expect = 1e-24
Identities = 34/53 (64%), Positives = 42/53 (79%)
Query: 1 STDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFP 53
TD + K WKECF V+GV+LPTGYYFG SAATGDLSDNHD++ ++ YEL+
Sbjct: 174 MTDIDGKNEWKECFDVTGVRLPTGYYFGASAATGDLSDNHDIISMKLYELDVE 226
|
The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER). Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 248 |
| >gnl|CDD|217528 pfam03388, Lectin_leg-like, Legume-like lectin family | Back alignment and domain information |
|---|
| >gnl|CDD|173892 cd07308, lectin_leg-like, legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >gnl|CDD|173890 cd06902, lectin_ERGIC-53_ERGL, ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 99.83 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 99.76 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 99.73 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 99.69 | |
| KOG3839|consensus | 351 | 99.64 | ||
| KOG3838|consensus | 497 | 99.61 | ||
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 99.56 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 98.01 | |
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 97.64 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 96.8 | |
| cd06900 | 255 | lectin_VcfQ VcfQ bacterial pilus biogenesis protei | 92.69 | |
| PF09116 | 112 | gp45-slide_C: gp45 sliding clamp, C terminal; Inte | 86.01 | |
| PHA02545 | 223 | 45 sliding clamp; Provisional | 82.92 |
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
Probab=99.83 E-value=6.3e-21 Score=134.95 Aligned_cols=57 Identities=60% Similarity=1.120 Sum_probs=53.8
Q ss_pred cccccccccccceeecceecCCCCeEEEeecCCCCCCCeeeEEEEEeeecCCCCcCC
Q psy7201 2 TDFENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEKLS 58 (65)
Q Consensus 2 ~di~~~~~w~~Cf~~~~v~LP~~~yfGiSAaTG~lsDnhDIis~~~~~l~~~~~~~~ 58 (65)
+|++++++|+.||++++|.||+++||||||+||+++|+|||++|++|++..+.++++
T Consensus 175 vd~~~~~~w~~Cf~~~~v~LP~~~yfGiSA~Tg~~sd~hdIlsv~~~~l~~~~~~~~ 231 (248)
T cd06901 175 TDIDGKNEWKECFDVTGVRLPTGYYFGASAATGDLSDNHDIISMKLYELDVEETPEE 231 (248)
T ss_pred EecCCCCceeeeEEeCCeecCCCCEEEEEecCCCCCCcEEEEEEEEecCcccccccc
Confidence 678899999999999999999999999999999999999999999999999988743
|
The vesicular integral protein of 36 kDa (VIP36) is a type 1 transmembrane protein of the mammalian early secretory pathway that acts as a cargo receptor transporting high mannose type glycoproteins between the Golgi and the endoplasmic reticulum (ER). Lectins of the early secretory pathway are involved in the selective transport of newly synthesized glycoproteins from the ER to the ER-Golgi intermediate compartment (ERGIC). The most prominent cycling lectin is the mannose-binding type1 membrane protein ERGIC-53, which functions as a cargo receptor to facilitate export of glycoproteins from the ER. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded she |
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >KOG3839|consensus | Back alignment and domain information |
|---|
| >KOG3838|consensus | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain | Back alignment and domain information |
|---|
| >PF09116 gp45-slide_C: gp45 sliding clamp, C terminal; InterPro: IPR015200 This domain is essential for the interaction of the gp45 sliding clamp with the corresponding polymerase | Back alignment and domain information |
|---|
| >PHA02545 45 sliding clamp; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 65 | ||||
| 2duo_A | 253 | Crystal Structure Of Vip36 ExoplasmicLUMENAL DOMAIN | 2e-14 | ||
| 1r1z_A | 263 | The Crystal Structure Of The Carbohydrate Recogniti | 3e-07 | ||
| 1gv9_A | 260 | P58ERGIC-53 Length = 260 | 3e-07 | ||
| 3a4u_A | 255 | Crystal Structure Of Mcfd2 In Complex With Carbohyd | 1e-06 | ||
| 3lcp_A | 247 | Crystal Structure Of The Carbohydrate Recognition D | 1e-06 |
| >pdb|2DUO|A Chain A, Crystal Structure Of Vip36 ExoplasmicLUMENAL DOMAIN, CA2+- Bound Form Length = 253 | Back alignment and structure |
|
| >pdb|1R1Z|A Chain A, The Crystal Structure Of The Carbohydrate Recognition Domain Of The Glycoprotein Sorting Receptor P58ERGIC-53 Reveals A Novel Metal Binding Site And Conformational Changes Associated With Calcium Ion Binding Length = 263 | Back alignment and structure |
| >pdb|1GV9|A Chain A, P58ERGIC-53 Length = 260 | Back alignment and structure |
| >pdb|3A4U|A Chain A, Crystal Structure Of Mcfd2 In Complex With Carbohydrate Recognition Domain Of Ergic-53 Length = 255 | Back alignment and structure |
| >pdb|3LCP|A Chain A, Crystal Structure Of The Carbohydrate Recognition Domain Of Complex With Mcfd2 Length = 247 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 8e-17 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 5e-16 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 4e-15 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 4e-15 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 1e-12 |
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 | Back alignment and structure |
|---|
Score = 70.3 bits (171), Expect = 8e-17
Identities = 23/52 (44%), Positives = 36/52 (69%)
Query: 5 ENKAAWKECFKVSGVKLPTGYYFGVSAATGDLSDNHDVLGIRTYELEFPGEK 56
+K ++ C KV + +PT +FG+SAATG L+D+HDVL T++L PG++
Sbjct: 206 PDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTEPGKE 257
|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Length = 226 | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Length = 222 | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Length = 256 | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 99.71 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 99.55 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 99.55 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 99.54 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 99.43 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 98.25 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 98.19 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 97.82 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 97.82 | |
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 97.79 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 97.78 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 97.77 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 97.77 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 97.71 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 97.67 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 97.66 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 97.64 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 97.63 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 97.6 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 97.45 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 97.42 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 97.42 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 97.36 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 97.31 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 97.13 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 97.11 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 97.04 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 97.01 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 96.9 | |
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 96.65 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 96.11 |
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
Probab=99.71 E-value=5.2e-18 Score=117.94 Aligned_cols=50 Identities=20% Similarity=0.400 Sum_probs=44.9
Q ss_pred cccccccccccceeecceecCCCC--eEEEeecCCCCCCCeeeEEEEEeeecCCCC
Q psy7201 2 TDFENKAAWKECFKVSGVKLPTGY--YFGVSAATGDLSDNHDVLGIRTYELEFPGE 55 (65)
Q Consensus 2 ~di~~~~~w~~Cf~~~~v~LP~~~--yfGiSAaTG~lsDnhDIis~~~~~l~~~~~ 55 (65)
|++|+ +.||++++|.||.++ ||||||+||+++|+|||++|++|++..+++
T Consensus 174 v~id~----~~Cf~~~~v~LP~g~~~yfGiSAaTg~~~D~hdils~~~~~~~~~~~ 225 (226)
T 2a6v_A 174 LQMDN----RVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDGVIEDS 225 (226)
T ss_dssp EEETT----EEEEEESCCCGGGTSCBEEEEEEECCTTCCEEEEEEEEEESSCCC--
T ss_pred EEEcC----CeeEEECCeecCCCCccEEEEEEcCCCCcccEEEEEEEEEecccccc
Confidence 56665 899999999999999 999999999999999999999999987753
|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 65 | ||||
| d2a6va1 | 218 | b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake | 8e-16 | |
| d2a6za1 | 221 | b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake | 1e-14 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 2e-13 | |
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 1e-06 | |
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 2e-06 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 4e-06 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 5e-05 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 2e-04 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 2e-04 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 2e-04 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 4e-04 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 4e-04 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 5e-04 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 0.001 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 0.001 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 0.002 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 0.002 |
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Lectin leg-like domain: Emp46p N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 65.8 bits (160), Expect = 8e-16
Identities = 9/52 (17%), Positives = 22/52 (42%), Gaps = 2/52 (3%)
Query: 1 STDFENKAAWKECFKVSGVKLPTG--YYFGVSAATGDLSDNHDVLGIRTYEL 50
+ + + + CF+ VK + G SA ++ ++L ++ Y+
Sbjct: 164 NHLLKLQMDNRVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDG 215
|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 99.55 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 99.32 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 99.29 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 98.54 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 98.42 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 98.36 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 98.34 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 98.31 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 98.16 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 98.13 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 98.06 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 98.02 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 97.97 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 97.91 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 97.74 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 97.57 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 97.36 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 97.1 | |
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 96.85 | |
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 96.83 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 96.83 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 96.68 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 96.35 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 96.17 | |
| d1b77a2 | 118 | gp45 sliding clamp {Bacteriophage RB69 [TaxId: 123 | 81.76 |
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Lectin leg-like domain: Emp46p N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.55 E-value=1.2e-15 Score=102.00 Aligned_cols=44 Identities=20% Similarity=0.421 Sum_probs=40.4
Q ss_pred ccccceeecceecCCC--CeEEEeecCCCCCCCeeeEEEEEeeecC
Q psy7201 9 AWKECFKVSGVKLPTG--YYFGVSAATGDLSDNHDVLGIRTYELEF 52 (65)
Q Consensus 9 ~w~~Cf~~~~v~LP~~--~yfGiSAaTG~lsDnhDIis~~~~~l~~ 52 (65)
+|+.||++.+|.||.+ +||||||+||+++|+|||++|++|+..+
T Consensus 172 d~~~c~~t~~i~lp~~~~~yfG~SA~Tg~~~d~~dIls~~~~~~~~ 217 (218)
T d2a6va1 172 DNRVCFQTRKVKFMGSSPFRIGTSAINDASKESFEILKMKLYDGVI 217 (218)
T ss_dssp TTEEEEEESCCCGGGTSCBEEEEEEECCTTCCEEEEEEEEEESSCC
T ss_pred CCcEEEEECCeecCCCCcEEEEEEECCCCCcCcEEEEEEEEEeccc
Confidence 3699999999999986 6899999999999999999999998765
|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1b77a2 d.131.1.2 (A:111-228) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]} | Back information, alignment and structure |
|---|