Diaphorina citri psyllid: psy7219

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

VYSYDLLCYTFSSTLVVFIFLAFKEEAYISPQNLPGLVALLLCYGCAVIPLMYPCSFIFSVPSTAFVVLGCFNLFVGLITTLTVTVLDNLQDDTLEYVNQYLKVIFLIFPHFCLGEGLMKLANTYWTSSFANSYGTRLVAVNIWAWRMIGKNLTCMACHGALYSAINLSIEYKVFSRCFTRSNPHPVPVSLEEDDVRKERERVERGADSGDVLVVKRLFKIYANSKDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR

cEEEEHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccccEEEEEccEEEcccccccccccccEEEECccccEEEccccccccccHHHHHHHccccccccEEEEEcccccccHHHcc

VYSYDLLCYTFSSTLVVFIFLAFKEEAYISPQNLPGLVALLLCYGCAVIPLMYPCSFIFSVPSTAFVVLGCFNLFVGLITTLTVTVLDNLQDDTLEYVNQYLKVIFLIFPHFCLGEGLMKLANTYWTSSFANSYGTRLVAVNIWAWRMIGKNLTCMACHGALYSAINLSIEYKVFSRCFTR************DDVRKERERVERGADSGDVLVVKRLFKIYANSKDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIR*******

xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0022892 [MF]	substrate-specific transporter activity	probable	GO:0005215, GO:0003674
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 212-277
View the alignment between query and template
View the model in PyMOL