Diaphorina citri psyllid: psy7224

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------

MKQKIELSVFETTIRFIGAILTLYSFTGDPMYRDKAVHIADKMLPAFKTPTGIPHALINVYTGDSKNYAWASGSASILSELGTLHLEFVYLSDVTGNPIYREKVEKIRSVISSIEKPNGLYPNYLNPKTGHWGQSHISMGALGDSFYEYLLKAWIQSNKEDTEGPESFKFTDTLEAKAYRSQDKYYILRPEVIESYFYLWRVTKDPKYREWGWDYVQMMKHAWDNYVTYAWGKNELKPLSRRGHSGSIFGSAELGMTIIDGLDTLYIMGLTDEYEDGKKWVAESLTLDDKTHKVVMG

ccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccECccccccccccccccccccHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccCEECcccccCCccCEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccc

*KQKIELSVFETTIRFIGAILTLYSFTGDPMYRDKAVHIADKMLPAFKTPTGIPHALINVYTGDSKNYAWASGSASILSELGTLHLEFVYLSDVTGNPIYREKVEKIRSVISSIEKPNGLYPNYLNPKTGHWGQSHISMGALGDSFYEYLLKAWIQSNKEDTEGPESFKFTDTLEAKAYRSQDKYYILRPEVIESYFYLWRVTKDPKYREWGWDYVQMMKHAWDNYVTYAWGKNELKPLSRRGHSGSIFGSAELGMTIIDGLDTLYIMGLTDEYEDGKKWVAESLTLDDKTHKVVMG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA	Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).	confident	O02773
Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA	Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).	confident	P33908
Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA	Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).	confident	P45700

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005793 [CC]	endoplasmic reticulum-Golgi intermediate compartment	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004559 [MF]	alpha-mannosidase activity	probable	GO:0016787, GO:0015923, GO:0016798, GO:0003824, GO:0003674, GO:0004553
GO:0035010 [BP]	encapsulation of foreign target	probable	GO:0002376, GO:0008150, GO:0002252
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0072347 [BP]	response to anesthetic	probable	GO:0008150, GO:0042221, GO:0050896, GO:0042493
GO:0006491 [BP]	N-glycan processing	probable	GO:0009311, GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0006486, GO:0006487, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0044260, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NXC, chain A
Confidence level:very confident
Coverage over the Query: 2-285
View the alignment between query and template
View the model in PyMOL