Diaphorina citri psyllid: psy7234


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MSNPSSQSVLDLKIGVASFCKAFPWHFIVDRKLELVQLGAGYMRLFGRCLKHLGSSVNNYFEIRRPNLLTVTFSSILKRVNSPFVIAIRLPQSLQNSPVEGLEFKGQMVYCPESESLLFVASPFLDALDNLTSRGLFISDIPLHDATRDVILVGEQARAQLAQT
cccccccccccccccHHHHHHccccEEEEccccEEEEccHHHHHHHcccccccccccccEEEEcccccccccHHHHHHcccccEEEEEcccccccccccccccccCEEEEEcccccEEEECccccccHHHHHHcccccccccccccHHHHHHHcHHHHHHHHcc
**********DLKIGVASFCKAFPWHFIVDRKLELVQLGAGYMRLFGRCLKHLGSSVNNYFEIRRPNLLTVTFSSILKRVNSPFVIAIRLPQSLQNSPVEGLEFKGQMVYCPESESLLFVASPFLDALDNLTSRGLFISDIPLHDATRDVILVGEQA*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNPSSQSVLDLKIGVASFCKAFPWHFIVDRKLELVQLGAGYMRLFGRCLKHLGSSVNNYFEIRRPNLLTVTFSSILKRVNSPFVIAIRLPQSLQNSPVEGLEFKGQMVYCPESESLLFVASPFLDALDNLTSRGLFISDIPLHDATRDVILVGEQARAQLAQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Head-specific guanylate cyclase May have a role in phototransduction. A second subunit may be required for enzyme activity.confidentQ07093

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P08, chain A
Confidence level:very confident
Coverage over the Query: 14-131
View the alignment between query and template
View the model in PyMOL
Template: 3HLS, chain A
Confidence level:confident
Coverage over the Query: 142-163
View the alignment between query and template
View the model in PyMOL