Diaphorina citri psyllid: psy723

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MSSVSDKSQTEINSPPGSPADQNEPLGNATALVPTLDSHPLLPIEQYRIQLYNYAIQAERLRLSQQYGTPYTNYQTPNVNRVMNYFHPRFQISSEEPKPQHSYIGLIAMAILSSPEMKLVLSDIYQYILDNYSYFRTRGPGWRNSIRHNLSLNDCFIKAGRSANGKGHYWSIHPANVDDFKKGDFRRRKAQRKVRRHMGLSVDDDNDSNSPPPLSPPLTFPNILFSSHPFQCFPQMLPPLGSTNTTSPCISRKRQFDVDSLLAPDHPASDLENTGKRQFDVDSLLAPDHPASDLENTDARKKLKPTSSPQTKVKHAASITDEVFERLQPGEEDRNKSDEEIDAENEADIDVVNNNNDSESEKVQESLILQRYYQTIALRRFQMYQQQLHQNPSEH
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
******************************A*VPTLDSHPLLPIEQYRIQLYNYAIQAERLRL**Q**T**********************I********HSYIGLIAMAILSSPEMKLVLSDIYQYILDNYSYFRTRGPGWRNSIRHNLSLNDCFIKAGRSANGKGHYWSIHPANVDDFKKGDF************************************************************************************************************************************************************************************SLILQRYYQTIALRRFQMY***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSVSDKSQTEINSPPGSPADQNEPLGNATALVPTLDSHPLLPIEQYRIQLYNYAIQAERLRLSQQYGTPYTNYQTPNVNRVMNYFHPRFQISSEEPKPQHSYIGLIAMAILSSPEMKLVLSDIYQYILDNYSYFRTRGPGWRNSIRHNLSLNDCFIKAGRSANGKGHYWSIHPANVDDFKKGDFRRRKAQRKVRRHMGLSVDDDNDSNSPPPLSPPLTFPNILFSSHPFQCFPQMLPPLGSTNTTSPCISRKRQFDVDSLLAPDHPASDLENTGKRQFDVDSLLAPDHPASDLENTDARKKLKPTSSPQTKVKHAASITDEVFERLQPGEEDRNKSDEEIDAENEADIDVVNNNNDSESEKVQESLILQRYYQTIALRRFQMYQQQLHQNPSEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HFH, chain A
Confidence level:very confident
Coverage over the Query: 97-186
View the alignment between query and template
View the model in PyMOL