Diaphorina citri psyllid: psy7241


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MSAAVMSSADSSVLSASSMFARNVYKLIFRQNVYFQRVLSSKSATQAQMLSYVAAFGCLIMAVPPVIIGAIAKSTDKVRSLAFC
cccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
**************SASSMFARNVYKLIFRQNVYFQRVLSSKSATQAQMLSYVAAFGCLIMAVPPVIIGAIAKSTDKVRSLAFC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAAVMSSADSSVLSASSMFARNVYKLIFRQNVYFQRVLSSKSATQAQMLSYVAAFGCLIMAVPPVIIGAIAKSTDKVRSLAFC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High affinity choline transporter 1 Imports choline from the extracellular space to the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion-dependent.confidentQ9GZV3
High affinity choline transporter 1 Imports choline from the extracellular space to the neuron with high affinity. Rate-limiting step in acetylcholine synthesis. Sodium ion and chloride ion dependent.confidentQ9JMD7
High affinity choline transporter 1 Imports choline from the extracellular space to the neuron with high affinity. Rate-limiting step in acetylcholine synthesis. Sodium ion and chloride ion dependent.confidentQ8BGY9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0033265 [MF]choline bindingprobableGO:0043169, GO:0043178, GO:0050997, GO:0043167, GO:0036094, GO:0003674, GO:0005488
GO:0015871 [BP]choline transportprobableGO:0015850, GO:0006812, GO:0006811, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005307 [MF]choline:sodium symporter activityprobableGO:0015220, GO:0015294, GO:0022891, GO:0022892, GO:0015291, GO:0015081, GO:0015293, GO:0022890, GO:0015077, GO:0008324, GO:1901618, GO:0015075, GO:0022857, GO:0015370, GO:0003674, GO:0005215, GO:0046873, GO:0015665, GO:0022804
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007271 [BP]synaptic transmission, cholinergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0007274 [BP]neuromuscular synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0035725 [BP]sodium ion transmembrane transportprobableGO:0009987, GO:0051234, GO:0006812, GO:0006811, GO:0006810, GO:0055085, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0044763, GO:0051179, GO:0006814, GO:0015672, GO:0044699
GO:0007269 [BP]neurotransmitter secretionprobableGO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0008292 [BP]acetylcholine biosynthetic processprobableGO:0019226, GO:0042133, GO:0042136, GO:0044249, GO:0006807, GO:0023052, GO:0001505, GO:0044699, GO:1901576, GO:0044710, GO:0035637, GO:0071704, GO:0065007, GO:0065008, GO:1900619, GO:0032501, GO:0050877, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:1900620, GO:0044237, GO:0044763, GO:0008291

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DH4, chain A
Confidence level:confident
Coverage over the Query: 3-49
View the alignment between query and template
View the model in PyMOL