Diaphorina citri psyllid: psy7249

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
EAKSKSGRESQRRKTPRFYAVVKDPESSSRTKGVKRKTRHSQDPPVEHHVGWILDVKEHRPRTSSEAKAKSGRESQRRKTPRFYAVVKDPESSSRTKGVKRKTRHSQDPPVEHHVGWILDVKEHRPRTSSVSSTGTSPCSSVPNSLPSFQHPSHALLKERHFTQEAYHKYHSRCLRERSRLGPGKSQEMNTLYRFWSFFLRDNFNRNMYKEFRSLAREDASLGFRYGYECLFRYFSYGLEKKFRPELYEDFQIETIHDYEN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
************************************************HVGWILD*************************************************************WI*******************************************FTQEAYHKYHSRCLR**S******SQEMNTLYRFWSFFLRDNFNRNMYKEFRSLAREDASLGFRYGYECLFRYFSYGLEKKFRPELYEDFQIETIHD***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EAKSKSGRESQRRKTPRFYAVVKDPESSSRTKGVKRKTRHSQDPPVEHHVGWILDVKEHRPRTSSEAKAKSGRESQRRKTPRFYAVVKDPESSSRTKGVKRKTRHSQDPPVEHHVGWILDVKEHRPRTSSVSSTGTSPCSSVPNSLPSFQHPSHALLKERHFTQEAYHKYHSRCLRERSRLGPGKSQEMNTLYRFWSFFLRDNFNRNMYKEFRSLAREDASLGFRYGYECLFRYFSYGLEKKFRPELYEDFQIETIHDYEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
La-related protein confidentQ9VAW5
La-related protein 1 confidentQ6PKG0
La-related protein 1 confidentQ6ZQ58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016239 [BP]positive regulation of macroautophagyprobableGO:0032106, GO:0032107, GO:0032104, GO:0032103, GO:0031329, GO:0032101, GO:0009896, GO:0048584, GO:0031323, GO:0009894, GO:0032109, GO:0010647, GO:0010646, GO:0050789, GO:0009893, GO:0019222, GO:0010508, GO:0065007, GO:0048518, GO:0010506, GO:0031325, GO:0016241, GO:0031331, GO:0048583, GO:0050794, GO:0008150, GO:0080134, GO:0080135, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted