Diaphorina citri psyllid: psy7279


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MGLFWFYSNKTSKVGQEHSELRPPRAPFSIRRFGRIPSIASTDSELSPPRAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDTVSMHSQHTV
cccccEEEcccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHccccCECcccccccccccccccccccccEEEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc
*GLFWFY*********************SIRRFGR************************QIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNA****************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLFWFYSNKTSKVGQEHSELRPPRAPFSIRRFGRIPSIASTDSELSPPRAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDTVSMHSQHTV

Function Prediction

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP4, chain A
Confidence level:very confident
Coverage over the Query: 73-125
View the alignment between query and template
View the model in PyMOL
Template: 2L0B, chain A
Confidence level:confident
Coverage over the Query: 49-122
View the alignment between query and template
View the model in PyMOL