Psyllid ID: psy7279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MGLFWFYSNKTSKVGQEHSELRPPRAPFSIRRFGRIPSIASTDSELSPPRAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDTVSMHSQHTV
cccccEEEccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHccccEEEcccccccccccccccccccccEEEEcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc
ccccEEEEcccccccccccccccccccccHHcccccccccccccccccccccccHHHHHcccccccccccccccccEEEHHccccccEEEEEcccccHcHHHccHHHHHcccccccccccccccccccccccccccccccccccccEEccHHHccccccccHHHcccccccccccccccccccccEEEccccccc
mglfwfysnktskvgqehselrpprapfsirrfgripsiastdselspprapfstrrfgqipsiafpadeapaaqcviclapfqpgeevKELLChhkfhseclepwlrerqhcplcrnavsvgsissengsswlsdttglshtdsyffltaeefsDAEAFAEALVEAfpqvfpedpidwnaengdtvsmhsqhtv
mglfwfysnktskvgqehselrpprapfsirrfgripsiastdselspprAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDTVSMHSQHTV
MGLFWFYSNKTSKVGQEHSELRPPRAPFSIRRFGRIPSIASTDSELSPPRAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVsvgsissengsswlsDTTGLSHTDSYFFLTaeefsdaeafaealveafPQVFPEDPIDWNAENGDTVSMHSQHTV
**LFWFY***************************************************GQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAV*********************HTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDW****************
*GLFWF**********************SIRRFGR************************QIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNA****************************************************************************
MGLFWFYSNK************PPRAPFSIRRFGRIPSIAS*********APFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDT*********
*GLFWFYSNKTSKVGQE*SELRPPRAPFS**RF****************************PSIAFPA**APAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNA****************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLFWFYSNKTSKVGQEHSELRPPRAPFSIRRFGRIPSIASTDSELSPPRAPFSTRRFGQIPSIAFPADEAPAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSVGSISSENGSSWLSDTTGLSHTDSYFFLTAEEFSDAEAFAEALVEAFPQVFPEDPIDWNAENGDTVSMHSQHTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
UNIPROTKB|F1SDD6231 F1SDD6 "Uncharacterized protei 0.364 0.307 0.310 5.1e-12
UNIPROTKB|I3LA46218 I3LA46 "Uncharacterized protei 0.241 0.215 0.404 2e-11
UNIPROTKB|I3LDQ5293 LOC100739432 "Uncharacterized 0.364 0.242 0.310 2.8e-11
WB|WBGene00012944487 Y47D3B.11 [Caenorhabditis eleg 0.307 0.123 0.4 4e-11
UNIPROTKB|Q9Y4L5304 RNF115 "E3 ubiquitin-protein l 0.364 0.233 0.310 4.3e-11
UNIPROTKB|Q7L0R7432 RNF44 "RING finger protein 44" 0.297 0.134 0.366 5.2e-11
UNIPROTKB|Q3T0W3153 RNF181 "E3 ubiquitin-protein l 0.461 0.588 0.329 7.4e-11
UNIPROTKB|F6RQU6293 RNF115 "Uncharacterized protei 0.364 0.242 0.310 1.2e-10
TAIR|locus:2053863185 RHA3A "RING-H2 finger A3A" [Ar 0.446 0.470 0.391 1.2e-10
TAIR|locus:2169063166 AT5G47610 [Arabidopsis thalian 0.456 0.536 0.343 1.2e-10
UNIPROTKB|F1SDD6 F1SDD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 5.1e-12, Sum P(2) = 5.1e-12
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query:    48 PPRAPFSTRRFGQIPSIAFPADEAPAA-QCVICLAPFQPGEEVKELLCHHKFHSECLEPW 106
             PP  P    +   +P++    ++     +C +C   +   EEV++L C+H FHS C+ PW
Sbjct:   128 PP--PADKEKITSLPTVTITQEQVDKGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPW 185

Query:   107 LRERQHCPLCRNAV 120
             L     CP+CR ++
Sbjct:   186 LELHDACPVCRKSL 199


GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|I3LA46 I3LA46 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDQ5 LOC100739432 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00012944 Y47D3B.11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4L5 RNF115 "E3 ubiquitin-protein ligase RNF115" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L0R7 RNF44 "RING finger protein 44" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W3 RNF181 "E3 ubiquitin-protein ligase RNF181" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6RQU6 RNF115 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2053863 RHA3A "RING-H2 finger A3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169063 AT5G47610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 7e-16
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 6e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 8e-10
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 4e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
smart0018440 smart00184, RING, Ring finger 9e-07
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-06
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 4e-06
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 2e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 2e-04
pfam1179370 pfam11793, FANCL_C, FANCL C-terminal domain 9e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.001
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 67.8 bits (166), Expect = 7e-16
 Identities = 26/43 (60%), Positives = 29/43 (67%)

Query: 75  QCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCR 117
           +C ICL  F+PGEEV  L C H FH ECL+ WLR    CPLCR
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
KOG4628|consensus348 99.54
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.53
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.44
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.32
PHA02929238 N1R/p28-like protein; Provisional 99.29
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.23
KOG0317|consensus293 99.19
KOG0823|consensus230 99.18
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.13
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.08
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.06
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.03
KOG0320|consensus187 98.99
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.95
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.93
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.92
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.91
PHA02926242 zinc finger-like protein; Provisional 98.91
KOG0802|consensus 543 98.89
PF1463444 zf-RING_5: zinc-RING finger domain 98.86
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.83
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.74
KOG1734|consensus328 98.67
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.66
KOG2164|consensus 513 98.6
KOG0287|consensus 442 98.58
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.54
KOG1493|consensus84 98.53
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.47
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.47
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.43
KOG0824|consensus 324 98.35
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.31
KOG0828|consensus636 98.3
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.29
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.26
COG52191525 Uncharacterized conserved protein, contains RING Z 98.25
KOG2177|consensus 386 98.19
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.17
KOG0311|consensus 381 98.12
KOG2930|consensus114 98.05
KOG4265|consensus349 98.05
KOG1039|consensus344 97.9
KOG0804|consensus 493 97.86
KOG0827|consensus 465 97.86
KOG4172|consensus62 97.77
KOG4445|consensus 368 97.72
KOG0978|consensus698 97.72
KOG0825|consensus 1134 97.71
KOG4159|consensus 398 97.56
KOG2660|consensus 331 97.49
KOG1785|consensus563 97.48
KOG1645|consensus 463 97.45
KOG0297|consensus 391 97.34
COG5152259 Uncharacterized conserved protein, contains RING a 97.24
KOG1941|consensus518 97.16
KOG1002|consensus 791 97.14
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.12
KOG4692|consensus489 97.1
KOG1813|consensus313 97.07
KOG2879|consensus298 96.97
KOG1428|consensus 3738 96.82
KOG0826|consensus357 96.71
KOG4275|consensus350 96.64
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.51
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.51
KOG3970|consensus 299 96.43
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.39
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.39
KOG4739|consensus 233 96.36
PHA02862156 5L protein; Provisional 96.28
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.23
KOG0801|consensus205 96.21
KOG1571|consensus355 96.17
COG5222427 Uncharacterized conserved protein, contains RING Z 96.16
PHA03096284 p28-like protein; Provisional 95.89
KOG3268|consensus234 95.82
KOG3039|consensus303 95.74
KOG2114|consensus933 95.73
PHA02825162 LAP/PHD finger-like protein; Provisional 95.67
KOG1814|consensus 445 95.67
KOG4185|consensus 296 95.5
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.38
KOG1952|consensus 950 95.35
PF04641260 Rtf2: Rtf2 RING-finger 95.09
KOG2034|consensus911 95.04
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.88
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.82
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.53
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.35
KOG1001|consensus674 94.02
KOG2932|consensus 389 93.98
KOG1940|consensus276 93.77
KOG3053|consensus 293 93.36
KOG0827|consensus 465 93.35
KOG1100|consensus207 93.06
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.03
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.14
KOG2817|consensus394 92.0
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.71
KOG0298|consensus 1394 91.5
KOG4367|consensus 699 91.31
KOG3899|consensus381 90.64
KOG3002|consensus 299 89.99
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 88.5
KOG4362|consensus 684 87.36
KOG3800|consensus 300 86.64
KOG1812|consensus 384 85.66
KOG1609|consensus 323 85.62
KOG0802|consensus543 83.63
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 83.6
KOG0309|consensus1081 83.49
PLN02436 1094 cellulose synthase A 81.03
KOG1812|consensus384 80.85
KOG0269|consensus839 80.82
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 80.66
>KOG4628|consensus Back     alignment and domain information
Probab=99.54  E-value=4.1e-15  Score=125.71  Aligned_cols=73  Identities=30%  Similarity=0.863  Sum_probs=62.0

Q ss_pred             CCCHHHHcCCCceecCCCCCC--CCccccccccccCCCceEEeCCCCccCccChhhhhccC-ccccccccccccCC
Q psy7279          52 PFSTRRFGQIPSIAFPADEAP--AAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRER-QHCPLCRNAVSVGS  124 (195)
Q Consensus        52 ~~s~~~~~~l~~~~~~~~~~~--~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~-~~CP~Cr~~~~~~~  124 (195)
                      .+.+..++.+|...+......  ...|+||+|+|..|+..+.|||+|.||..||..||... ..||+||..+....
T Consensus       206 r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  206 RLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             hhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCC
Confidence            458888999998888776553  23899999999999999999999999999999999886 45999999776543



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 4e-19
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-18
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-18
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-18
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 5e-18
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-13
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 3e-08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 7e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 9e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 7e-07
3nw0_A238 Non-structural maintenance of chromosomes element 1e-06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 8e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-04
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 8e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 76.6 bits (189), Expect = 4e-19
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 60  QIPSIAFPADEAPA--AQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCR 117
           Q+PS  F  +   +    CV+C+  F+  + ++ L C+H+FH++C++ WL+  + CP+CR
Sbjct: 8   QLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 67

Query: 118 NAVS 121
               
Sbjct: 68  ADSG 71


>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.7
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.63
2ect_A78 Ring finger protein 126; metal binding protein, st 99.56
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.54
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.53
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.52
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.48
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.47
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.45
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.44
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.42
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.42
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.41
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.4
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.38
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.38
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.37
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.37
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.37
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.35
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.35
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.35
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.34
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.34
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.34
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.33
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.32
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.3
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.3
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.3
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.28
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.24
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.23
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.21
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.21
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.21
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.2
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.2
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.19
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.17
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.16
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.16
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.15
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.15
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.14
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.12
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.12
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.11
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.09
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.01
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.01
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.0
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.99
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.96
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.96
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.88
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.83
2ea5_A68 Cell growth regulator with ring finger domain prot 98.81
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.8
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.8
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.74
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.66
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.65
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.64
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.61
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.51
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.22
3nw0_A238 Non-structural maintenance of chromosomes element 97.87
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.66
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.53
1we9_A64 PHD finger family protein; structural genomics, PH 93.8
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.61
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 89.92
2k16_A75 Transcription initiation factor TFIID subunit 3; p 89.57
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 89.31
1wil_A89 KIAA1045 protein; ring finger domain, structural g 88.55
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 88.03
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 87.96
2a20_A62 Regulating synaptic membrane exocytosis protein 2; 87.86
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 87.49
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 87.41
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 87.16
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 86.93
2yt5_A66 Metal-response element-binding transcription facto 86.81
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 86.39
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 86.27
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 85.63
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 85.5
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 85.46
1weu_A91 Inhibitor of growth family, member 4; structural g 85.22
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 85.17
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 84.82
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 83.15
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 81.47
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 81.37
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 81.16
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 80.55
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 80.02
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.70  E-value=1.3e-17  Score=115.75  Aligned_cols=74  Identities=31%  Similarity=0.736  Sum_probs=63.9

Q ss_pred             CCCCCCHHHHcCCCceecCCCCC---CCCccccccccccCCCceEEeCCCCccCccChhhhhccCcccccccccccc
Q psy7279          49 PRAPFSTRRFGQIPSIAFPADEA---PAAQCVICLAPFQPGEEVKELLCHHKFHSECLEPWLRERQHCPLCRNAVSV  122 (195)
Q Consensus        49 p~~~~s~~~~~~l~~~~~~~~~~---~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~  122 (195)
                      ...+++++.++.||...+.....   .+..|+||++.|..++.++.++|+|.||..||..|+..+.+||+||..+..
T Consensus        13 ~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            34567999999999988776542   367899999999987788999999999999999999999999999998754



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-08
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 9e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 6e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 1e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 4e-04
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 0.002
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 68.4 bits (167), Expect = 2e-16
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 74  AQCVICLAPFQPGEEVKELL-CHHKFHSECLEPWLRERQHCPLCRNAVSV 122
            +C +CLA  + GEE + L  C H FH+EC++ WL     CPLCR  V V
Sbjct: 6   VECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV 55


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.65
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.52
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.46
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.42
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.41
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.41
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.37
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.35
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.35
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.34
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.25
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.24
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.19
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.1
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.93
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.41
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 94.17
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.87
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 92.17
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.81
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.59
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 89.3
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 88.6
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 86.96
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 84.8
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 82.29
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 82.23
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 80.78
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.65  E-value=3.7e-17  Score=101.62  Aligned_cols=49  Identities=45%  Similarity=1.055  Sum_probs=44.4

Q ss_pred             CCccccccccccCCCceEEeC-CCCccCccChhhhhccCccccccccccc
Q psy7279          73 AAQCVICLAPFQPGEEVKELL-CHHKFHSECLEPWLRERQHCPLCRNAVS  121 (195)
Q Consensus        73 ~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~  121 (195)
                      +..|+||++.|..++.+..++ |+|.||..||.+|++.+.+||+||+.+.
T Consensus         5 ~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             SCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            567999999999888888875 9999999999999999999999999763



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure