Psyllid ID: psy7302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-
MALKNDANLCKPGLRCCVSKDAYSGTLPPNLVIMERNGTKPNSGSQSSSTTPYVSSTSAVTQTTTSRPQQPAGSKPCHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLESPANGTTPAAGGSTTSNAGTSSPSTTTPPTLYTTSKPYKKPQNPEKRPQPPGASNKIDTGGNNNCLGVTTTNKPPSSQPSNLPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNTRLPPPTKPKPRPTQPPTTTTVATTTAVPDDRPECPGSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVLDQKNGVSPSYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNNLR
cccccccccccccccEEEEcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEcccEEEEcccccccccccccEEEEEEccEEccccccccccEEEEEEEEEEccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEccccHHHHHHHHHcccccccccccccEEEcccccccccccccccEEEEEEccEEEEEEEEEcccccccccccEEEEEccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccc
ccccccccccccccEEEccccccccccccccEEEEccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccEEcccccccccccEEcccHHHHcccccEEEccEEEEccccccccccccccccccccccccccccccEccccEEccccccccccccHHccccccccccEEccccEEcccccccccccccccccccHHcccccccccccccEEEEcccccccccccccccccHHHHHHccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccHHcEccEEccccccccEEEEEcccccEEEEEEEEEccEEEEcHHHHcccccccccEEEEEEEccccccccccccEEEcEEEEEEccccEccccEcccEEEEEcccccccccccccEccccccccccccEEEEEEcHEccccccEccEcEEEEEEEccHHHHHHHccccEEccccccccEEEEcEcccEcccccccccEEEEEEccEEEEEEEEEEcccccccccEEEEEEHHHHHHHccccccccEEEEEEccEEEEEEEEEEEcccccccccEEEEEHHHHHHHHHHHHHHcccc
malkndanlckpglrccvskdaysgtlppnlvimerngtkpnsgsqsssttpyvsstsavtqtttsrpqqpagskpchglldtitstaeskdcpgtCVHAIATLICAevlddvqcpspsmrcclespangttpaaggsttsnagtsspstttpptlyttskpykkpqnpekrpqppgasnkidtggnnnclgvtttnkppssqpsnlpkcpgfcLLNIMAAfcerpsvlipqtstcsrgsmccdntrlppptkpkprptqppttttvatttavpddrpecpgscivsylSFTCFRNAEMTEIfkckksgtqccapksVIREVLdqkngvspsyptysttsttvrpavynkyvcgvkgtarergarvvggedaDMLCQLYVTVWGAIVLhnglrtqefrqkrppfqcniclfaasyptysttsttvrpavynkyvcgvkgtarergarvvggedadpaeWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVrvgdhdltrkygspgaqtLRVATTYIhhnhnsqtlDNDIALLKLHgqaelkdgvclvclpargvnhaagkrctvtgygymgeagpiplrvreaeipivsdtECIRKINAVTEKIFilpassfcaggeegndacqgdgggplvcqddgfyELAGLVswgfgcgrqdvpgvYVKVSSfngmskvgdgggplvcqddgfyELAGLVswgfgcgrqdvpgvYVKVSSFIGWINQIISVNNLR
malkndanlckpglrccvskdaysgtlPPNLVIMERNGTkpnsgsqsssttpyVSSTSAVTQtttsrpqqpagskpcHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLESPANGTTPAAGgsttsnagtsspstttpptlyttskpykkpqnpekrpqppgASNKIDTGGNNNCLGVTTTnkppssqpsnLPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNtrlppptkpkprptqppttttvatttavpddrpeCPGSCIVSYLSFTCFRNAEMTEIfkckksgtqCCAPKSVIREvldqkngvspsyptysttsttvrpavynKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASYPTYsttsttvrpavynKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHdltrkygspgaQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPArgvnhaagkrcTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSfigwinqiisvnnlr
MALKNDANLCKPGLRCCVSKDAYSGTLPPNLVIMERNGTKPNsgsqsssttpyvsstsavtqtttsRPQQPAGSKPCHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLEspangttpaaggsttsnagtsspstttpptlyttskpykkpQNPEKRPQPPGASNKIDTGGNNNCLGVTTTNKPPSSQPSNLPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNtrlppptkpkprptqppttttvatttavpDDRPECPGSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVLDQKNGVspsyptysttsttVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAAsyptysttsttVRPAVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNNLR
********LCKPGLRCCVSKDAYSGTLPPNLVI**********************************************LLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCC*************************************************************************************KCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMC***************************************GSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVL**********************AVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASY************AVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISV****
*ALKNDANLCKPGLRCCVSKDAYSGTLPPNLVI*************************************************************GTCVHAIATLICAEVLDDVQCPSPSMRCCLESPANGTT*****************************************************GNNNCL********************GFCLLNIMAAFCERPSVLIPQTSTCSRGSMCC**************************************GSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSV****************TYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIV********************ICLF***********************CGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKY*S**AQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGG*****Q***FYELAGLVSWG******D**GVYVKVSSFIGWINQIISV****
MALKNDANLCKPGLRCCVSKDAYSGTLPPNLVIMERNG*************************************PCHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLESPA*************************PTLYTTS******************SNKIDTGGNNNCLGVTTT**********LPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNTRLPP*********************AVPDDRPECPGSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVLDQKNGVSPSYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNNLR
*****DANLCKPGLRCCVSKDAYSGTLPPNLVIMERNG****************SST**VTQTTTSRPQQPAGSKPCHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLESP*************************PPT*****************PQPPGASNKIDTGGNNNCLGVTTTNKPPSSQPSNLPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNTRLPPPTKPKPRPTQPPTTTTVATTTAVPDDRPECPGSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVLDQKNGVSPSYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNNL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKNDANLCKPGLRCCVSKDAYSGTLPPNLVIMERNGTKPNSGSQSSSTTPYVSSTSAVTQTTTSRPQQPAGSKPCHGLLDTITSTAESKDCPGTCVHAIATLICAEVLDDVQCPSPSMRCCLESPANGTTPAAGGSTTSNAGTSSPSTTTPPTLYTTSKPYKKPQNPEKRPQPPGASNKIDTGGNNNCLGVTTTNKPPSSQPSNLPKCPGFCLLNIMAAFCERPSVLIPQTSTCSRGSMCCDNTRLPPPTKPKPRPTQPPTTTTVATTTAVPDDRPECPGSCIVSYLSFTCFRNAEMTEIFKCKKSGTQCCAPKSVIREVLDQKNGVSPSYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADMLCQLYVTVWGAIVLHNGLRTQEFRQKRPPFQCNICLFAASYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNNLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query741
FB|FBgn00116531047 mas "masquerade" [Drosophila m 0.346 0.245 0.876 3e-187
UNIPROTKB|F1NZZ9805 OVCH2 "Uncharacterized protein 0.315 0.290 0.392 5.9e-36
UNIPROTKB|F1RIS0855 F1RIS0 "Uncharacterized protei 0.319 0.277 0.377 5.7e-39
UNIPROTKB|F1PXI5 581 PRSS42 "Uncharacterized protei 0.327 0.418 0.338 7.5e-43
UNIPROTKB|E1B9Z91095 TMPRSS9 "Uncharacterized prote 0.315 0.213 0.353 1e-30
UNIPROTKB|I3LDL11047 TMPRSS9 "Uncharacterized prote 0.315 0.223 0.357 1e-31
ZFIN|ZDB-GENE-040426-834 556 zgc:55888 "zgc:55888" [Danio r 0.288 0.384 0.383 1.8e-40
UNIPROTKB|F1NP62 983 F1NP62 "Uncharacterized protei 0.310 0.233 0.334 5.2e-40
UNIPROTKB|Q7Z4101059 TMPRSS9 "Transmembrane proteas 0.314 0.220 0.357 3.8e-31
UNIPROTKB|D4A2A8 849 Prss36 "Polyserase-2" [Rattus 0.330 0.288 0.388 1.5e-39
FB|FBgn0011653 mas "masquerade" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1213 (432.1 bits), Expect = 3.0e-187, Sum P(4) = 3.0e-187
 Identities = 227/259 (87%), Positives = 239/259 (92%)

Query:   425 VRPAVYN-KYVCGVKGT-ARERGARVVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQ 482
             V P  Y  + + G++   +  R ARVVGGED +  EWCWQVALINSLNQYLCG ALIGTQ
Sbjct:   778 VYPEYYQQRSLYGLQSNFSGRRRARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQ 837

Query:   483 WVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDI 542
             WVLTAAHCVTNIVRSGDA+YVRVGD+DLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDI
Sbjct:   838 WVLTAAHCVTNIVRSGDAIYVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDI 897

Query:   543 ALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVS 602
             ALLKLHGQAEL+DGVCLVCLPARGV+HAAGKRCTVTGY YMGEAGPIPLRVREAEIPIVS
Sbjct:   898 ALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCTVTGYRYMGEAGPIPLRVREAEIPIVS 957

Query:   603 DTECIRKINAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGF 662
             DTECIRK+NAVTEKIFILPASSFCAGGEEG+DACQGDGGGPLVCQDDGFYELAGLVSWGF
Sbjct:   958 DTECIRKVNAVTEKIFILPASSFCAGGEEGHDACQGDGGGPLVCQDDGFYELAGLVSWGF 1017

Query:   663 GCGRQDVPGVYVKVSSFNG 681
             GCGRQDVPGVYVK SSF G
Sbjct:  1018 GCGRQDVPGVYVKTSSFIG 1036
GO:0005886 "plasma membrane" evidence=IDA
GO:0008233 "peptidase activity" evidence=TAS
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS
GO:0006508 "proteolysis" evidence=IEA
UNIPROTKB|F1NZZ9 OVCH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIS0 F1RIS0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXI5 PRSS42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9Z9 TMPRSS9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDL1 TMPRSS9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-834 zgc:55888 "zgc:55888" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP62 F1NP62 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z410 TMPRSS9 "Transmembrane protease serine 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2A8 Prss36 "Polyserase-2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query741
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 2e-84
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 1e-78
pfam00089218 pfam00089, Trypsin, Trypsin 6e-55
COG5640413 COG5640, COG5640, Secreted trypsin-like serine pro 4e-26
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information 
 Score =  266 bits (683), Expect = 2e-84
 Identities = 108/233 (46%), Positives = 140/233 (60%), Gaps = 9/233 (3%)

Query: 448 VVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGD 507
           +VGG +A    + WQV+L  +  ++ CGG+LI  +WVLTAAHCV +   S     VR+G 
Sbjct: 1   IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPS--NYTVRLGS 58

Query: 508 HDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGV 567
           HDL+      G Q ++V    +H N+N  T DNDIALLKL     L D V  +CLP+ G 
Sbjct: 59  HDLSS--NEGGGQVIKVKKVIVHPNYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGY 116

Query: 568 NHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCA 627
           N  AG  CTV+G+G   E GP+P  ++E  +PIVS+ EC R           +  +  CA
Sbjct: 117 NLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRA----YSYGGTITDNMLCA 172

Query: 628 GGEEGN-DACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSF 679
           GG EG  DACQGD GGPLVC D+G   L G+VSWG GC R + PGVY +VSS+
Sbjct: 173 GGLEGGKDACQGDSGGPLVCNDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSY 225

Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 741
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 100.0
KOG3627|consensus256 100.0
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 100.0
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 100.0
COG5640413 Secreted trypsin-like serine protease [Posttransla 99.96
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 99.68
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 99.46
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.51
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 98.38
COG5640 413 Secreted trypsin-like serine protease [Posttransla 98.3
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 97.96
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 97.96
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.88
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 97.85
PRK10898353 serine endoprotease; Provisional 97.79
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.77
PRK10139 455 serine endoprotease; Provisional 97.37
PRK10942 473 serine endoprotease; Provisional 97.26
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 94.39
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 87.19
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information 
Probab=100.00  E-value=4.3e-40  Score=332.04  Aligned_cols=230  Identities=47%  Similarity=0.844  Sum_probs=201.0

Q ss_pred             eeCCeecCCCCcceEEEEEeeCCceeEEEEEeccceEEeecccccccccCCCcEEEEEceeccccccCCCCcEEEEEEEE
Q psy7302         448 VVGGEDADPAEWCWQVALINSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRVGDHDLTRKYGSPGAQTLRVATT  527 (741)
Q Consensus       448 IvGG~~a~~ge~PW~VsL~~~~~~~~CgGTLIS~rwVLTAAHCv~~~~~~~~~i~V~lG~~~l~~~~~~~~~q~~~V~~I  527 (741)
                      |+||+.+..++|||+|+|+.....++|+|+||+++||||||||+.+..  ...+.|++|.......  ....+.+.|.++
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaAhC~~~~~--~~~~~v~~g~~~~~~~--~~~~~~~~v~~~   76 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSA--PSNYTVRLGSHDLSSN--EGGGQVIKVKKV   76 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccCCcEEEEEEEeeCCEEEECHHhcCCCC--CccEEEEeCcccccCC--CCceEEEEEEEE
Confidence            689999999999999999876567999999999999999999997643  4578899998776432  134578899999


Q ss_pred             EEecCCCCCCCCCceEEEEeccccccCCceeEEecCCCCCcCCCCCeEEEEEecccCCCCCCcceeEEEEEeeeChhHHH
Q psy7302         528 YIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPARGVNHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECI  607 (741)
Q Consensus       528 iiHP~Y~~~t~~nDIALLkL~~pi~~s~~V~PICLP~~~~~~~~g~~~~v~GWG~t~~~~~~s~~L~~~~v~vis~~~C~  607 (741)
                      ++||+|+.....+|||||||++++.++++++|||||........+..+.++|||...........+++..+.+++..+|.
T Consensus        77 ~~hp~y~~~~~~~DiAll~L~~~~~~~~~v~picl~~~~~~~~~~~~~~~~G~g~~~~~~~~~~~~~~~~~~~~~~~~C~  156 (232)
T cd00190          77 IVHPNYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECK  156 (232)
T ss_pred             EECCCCCCCCCcCCEEEEEECCcccCCCcccceECCCccccCCCCCEEEEEeCCcCCCCCCCCceeeEEEeeeECHHHhh
Confidence            99999998888999999999999999999999999987655677899999999987655456778999999999999998


Q ss_pred             HhhccccccccccCCCeEEecCCC-CCCCCCCCCCCceEEeeCCeEEEEEEEecCCCCCCCCCCceeeeccccCCCccc
Q psy7302         608 RKINAVTEKIFILPASSFCAGGEE-GNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFNGMSKV  685 (741)
Q Consensus       608 ~~~~~~~~~~~~i~~~~~CAg~~~-g~~~C~GDSGGPLv~~~~g~~~LvGVvS~G~gC~~~~~P~VYtrVS~y~~wI~~  685 (741)
                      ..+..    ...+.+++||++... ..+.|.|||||||++..+++|+|+||+|+|..|...+.|++|++|+.|.+||..
T Consensus       157 ~~~~~----~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~~~~~~lvGI~s~g~~c~~~~~~~~~t~v~~~~~WI~~  231 (232)
T cd00190         157 RAYSY----GGTITDNMLCAGGLEGGKDACQGDSGGPLVCNDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQK  231 (232)
T ss_pred             hhccC----cccCCCceEeeCCCCCCCccccCCCCCcEEEEeCCEEEEEEEEehhhccCCCCCCCEEEEcHHhhHHhhc
Confidence            87753    124678999999766 789999999999999999999999999999999888899999999999999974

Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.
>KOG3627|consensus Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query741
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 4e-89
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 5e-80
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 6e-80
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 7e-80
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 3e-79
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 3e-78
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 4e-78
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 1e-77
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 5e-77
3bg8_A238 Coagulation factor XIA light chain; protease inhib 6e-77
1aut_C250 Activated protein C; serine proteinase, plasma cal 4e-76
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 5e-76
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 1e-75
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 2e-75
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 3e-75
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 6e-75
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 1e-74
2jde_A276 Urokinase-type plasminogen activator; plasminogen 2e-74
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 3e-74
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 3e-74
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 5e-74
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 7e-74
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 8e-74
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 9e-74
2xw9_A228 Complement factor D; immune system, hydrolase, ser 3e-73
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 3e-73
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 3e-73
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 3e-73
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 6e-73
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 7e-73
1elv_A333 Complement C1S component; trypsin-like serin prote 7e-73
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 1e-72
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 1e-72
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 1e-72
2r0l_A248 Hepatocyte growth factor activator; serine proteas 2e-72
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 2e-72
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 3e-72
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 8e-72
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 9e-72
2asu_B234 Hepatocyte growth factor-like protein; serine prot 1e-71
2xxl_A408 GRAM-positive specific serine protease, isoform B; 3e-71
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 4e-71
1a7s_A225 Heparin binding protein; serine protease homolog, 5e-71
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 7e-71
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 8e-71
2qy0_B242 Complement C1R subcomponent; serine protease, beta 9e-71
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-70
1md8_A329 C1R complement serine protease; innate immunity, a 2e-70
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 2e-70
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 3e-70
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 3e-70
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 4e-70
1euf_A227 Duodenase; serine protease, dual specificity, hydr 5e-70
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 9e-70
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 1e-69
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 1e-69
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 1e-69
2z7f_E218 Leukocyte elastase; serine protease, serine protea 1e-69
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 2e-69
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 3e-69
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 3e-69
1azz_A226 Collagenase; complex (serine protease/inhibitor), 4e-69
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 5e-69
1gpz_A399 Complement C1R component; hydrolase, activation, i 8e-69
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 1e-68
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 2e-68
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 4e-68
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 4e-68
2aiq_A231 Protein C activator; snake venom serine proteinase 6e-68
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 7e-68
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 2e-67
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 2e-67
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 2e-66
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-66
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 4e-66
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 6e-66
2xrc_A565 Human complement factor I; immune system, hydrolas 7e-66
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 4e-65
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 5e-65
1ao5_A237 Glandular kallikrein-13; serine protease, protein 9e-65
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 5e-63
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 2e-62
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 2e-62
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 2e-62
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 5e-62
2odp_A509 Complement C2; C3/C5 convertase, complement serin 7e-60
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 6e-59
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 3e-51
3hrz_D741 Complement factor B; serine protease, glycosilated 8e-47
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 9e-42
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 9e-38
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 4e-28
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 2e-22
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 2e-19
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 3e-13
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
 Score =  284 bits (728), Expect = 4e-89
 Identities = 89/302 (29%), Positives = 136/302 (45%), Gaps = 18/302 (5%)

Query: 392 LRTQEFRQKRPPFQCNICLFAASYPTYSTTSTTVRPAVYNKYVCGVKGTARERGARVVGG 451
           +R      +     C  C         + + T     V     CG++   R    ++ G 
Sbjct: 77  IRENANECESYLDVC--CGLPEGGVLPTPSPTPPVVPVLKPSFCGIR-NERGLDFKITGQ 133

Query: 452 -EDADPAEWCWQVALI-------NSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYV 503
             +A+  E+ W VA++       +   Q +CGG+LI    VLT AHCV +   + DA+ +
Sbjct: 134 TNEAEYGEFPWMVAVLKANVIPGSGEEQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKI 193

Query: 504 RVGDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLP 563
           R G+ D   +      Q  ++    IH N N +T+ ND+ALL L       D +  +CLP
Sbjct: 194 RAGEWDTLTEKERLPYQERKIRQVIIHSNFNPKTVVNDVALLLLDRPLVQADNIGTICLP 253

Query: 564 ARGVNHAAGKRCTVTGYGY--MGEAGPIPLRVREAEIPIVSDTECIRKI-NAVTEKIFIL 620
            +         C  +G+G    G        +++ ++P V   +C   + N      F+L
Sbjct: 254 QQSQIF-DSTECFASGWGKKEFGSRHRYSNILKKIQLPTVDRDKCQADLRNTRLGLKFVL 312

Query: 621 PASSFCAGGEEGNDACQGDGGGPLVCQD---DGFYELAGLVSWGFGCGRQDVPGVYVKVS 677
             +  CAGGE+G D C GDGG PL C D      Y   G+V+WG GCG ++VPGVY  V+
Sbjct: 313 DQTFVCAGGEQGKDTCTGDGGSPLFCPDPRNPSRYMQMGIVAWGIGCGDENVPGVYANVA 372

Query: 678 SF 679
            F
Sbjct: 373 HF 374
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query741
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 100.0
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 100.0
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 100.0
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 100.0
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 100.0
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 100.0
2jde_A276 Urokinase-type plasminogen activator; plasminogen 100.0
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 100.0
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 100.0
3bg8_A238 Coagulation factor XIA light chain; protease inhib 100.0
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 100.0
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 100.0
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 100.0
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 100.0
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 100.0
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 100.0
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 100.0
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 100.0
1aut_C250 Activated protein C; serine proteinase, plasma cal 100.0
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 100.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 100.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 100.0
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 100.0
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 100.0
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 100.0
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 100.0
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 100.0
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 100.0
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 100.0
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 100.0
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 100.0
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 100.0
2r0l_A248 Hepatocyte growth factor activator; serine proteas 100.0
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 100.0
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 100.0
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 100.0
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 100.0
2xxl_A408 GRAM-positive specific serine protease, isoform B; 100.0
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 100.0
2asu_B234 Hepatocyte growth factor-like protein; serine prot 100.0
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 100.0
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 100.0
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 100.0
1md8_A329 C1R complement serine protease; innate immunity, a 100.0
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 100.0
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 100.0
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 100.0
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 100.0
1elv_A333 Complement C1S component; trypsin-like serin prote 100.0
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 100.0
1euf_A227 Duodenase; serine protease, dual specificity, hydr 100.0
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 100.0
2qy0_B242 Complement C1R subcomponent; serine protease, beta 100.0
2xw9_A228 Complement factor D; immune system, hydrolase, ser 100.0
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 100.0
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 100.0
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 100.0
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 100.0
1ao5_A237 Glandular kallikrein-13; serine protease, protein 100.0
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 100.0
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 100.0
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 100.0
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 100.0
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 100.0
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 100.0
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 100.0
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 100.0
1azz_A226 Collagenase; complex (serine protease/inhibitor), 100.0
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 100.0
1gpz_A399 Complement C1R component; hydrolase, activation, i 100.0
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 100.0
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 100.0
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 100.0
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 100.0
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 100.0
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 100.0
2aiq_A231 Protein C activator; snake venom serine proteinase 100.0
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 100.0
2z7f_E218 Leukocyte elastase; serine protease, serine protea 100.0
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 100.0
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 100.0
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 100.0
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 100.0
1a7s_A225 Heparin binding protein; serine protease homolog, 100.0
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 100.0
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 100.0
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 100.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 100.0
2xrc_A565 Human complement factor I; immune system, hydrolas 100.0
2odp_A509 Complement C2; C3/C5 convertase, complement serin 100.0
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 100.0
3hrz_D741 Complement factor B; serine protease, glycosilated 100.0
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 100.0
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 99.97
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.96
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.95
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.93
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.93
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.93
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.92
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.92
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.92
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.86
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.84
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.84
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.8
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.76
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.72
3k6y_A237 Serine protease, possible membrane-associated seri 99.58
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.48
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.47
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.47
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.45
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.42
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.35
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.34
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.31
1hpg_A187 Glutamic acid specific protease; serine protease, 99.17
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.16
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.16
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.94
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.91
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.71
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.64
2oua_A188 Serine protease, protein NAPA; kinetic stability, 98.61
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 98.23
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 98.09
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 98.04
2w5e_A163 Putative serine protease; coiled coil, transmembra 97.85
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 97.6
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.55
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 97.51
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 97.43
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 97.43
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 97.21
2qy0_B242 Complement C1R subcomponent; serine protease, beta 97.18
1md8_A329 C1R complement serine protease; innate immunity, a 97.12
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 97.11
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 97.07
1elv_A333 Complement C1S component; trypsin-like serin prote 96.96
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 96.44
2odp_A509 Complement C2; C3/C5 convertase, complement serin 96.06
3hrz_D741 Complement factor B; serine protease, glycosilated 95.7
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 94.94
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 94.91
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 94.9
1gpz_A399 Complement C1R component; hydrolase, activation, i 94.0
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 93.46
1hpg_A187 Glutamic acid specific protease; serine protease, 93.43
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 92.93
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 92.47
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 92.4
5hpg_A84 Plasminogen; serine protease, kringle 5, fibrinoly 91.92
1jfn_A119 APO(A) KIV-T6, apolipoprotein A, KIV-T6, apolipopr 91.86
1i71_A83 APO(A), apolipoprotein(A); alipoprotein(A), kringl 91.27
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 91.27
3syj_A 1011 Adhesion and penetration protein autotransporter; 90.94
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 89.48
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 89.45
1pml_A86 Tissue plasminogen activator kringle 2; hydrolase( 89.32
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 89.17
2asu_B234 Hepatocyte growth factor-like protein; serine prot 88.92
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 88.81
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 88.54
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 88.49
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 88.45
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 88.39
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 88.33
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 88.13
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 88.09
3bg8_A238 Coagulation factor XIA light chain; protease inhib 88.08
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 88.06
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 87.97
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 87.83
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 87.77
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 87.76
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 87.67
2jde_A276 Urokinase-type plasminogen activator; plasminogen 87.62
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 87.62
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 87.56
1aut_C250 Activated protein C; serine proteinase, plasma cal 87.49
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 87.47
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 87.36
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 87.02
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 86.9
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 86.89
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 86.88
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 86.86
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 86.72
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 86.68
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 86.52
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 86.39
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 86.31
2r0l_A248 Hepatocyte growth factor activator; serine proteas 86.15
1ao5_A237 Glandular kallikrein-13; serine protease, protein 86.03
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 86.03
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 85.97
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 85.91
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 85.84
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 85.66
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 85.53
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 85.5
3k65_A116 Prothrombin; coagulation, zymogen, hydrolase; 1.85 85.3
2xxl_A408 GRAM-positive specific serine protease, isoform B; 85.24
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 85.24
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 85.2
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 85.15
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 85.06
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 85.05
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 85.02
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 84.94
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 84.84
3e6p_L158 Prothrombin; meizothrombin, allostery, linkage, Na 84.52
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 84.28
2aiq_A231 Protein C activator; snake venom serine proteinase 84.09
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 83.98
2qj2_A184 Hepatocyte growth factor; HGF/SF, hormone/growth f 83.89
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 83.62
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 83.51
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 83.49
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 83.4
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 83.25
2xw9_A228 Complement factor D; immune system, hydrolase, ser 83.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 82.76
1nl1_A147 Prothrombin; hydrolase; HET: CGU NAG; 1.90A {Bos t 81.74
1euf_A227 Duodenase; serine protease, dual specificity, hydr 80.93
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 80.68
2xrc_A565 Human complement factor I; immune system, hydrolas 80.65
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 80.6
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 80.09
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=6e-50  Score=446.39  Aligned_cols=240  Identities=35%  Similarity=0.626  Sum_probs=193.3

Q ss_pred             CCceeCCeecCCCCcceEEEEEeeC-CceeEEEEEeccceEEeeccccccc----ccCCCcEEEEEceeccccccCCCCc
Q psy7302         445 GARVVGGEDADPAEWCWQVALINSL-NQYLCGGALIGTQWVLTAAHCVTNI----VRSGDAVYVRVGDHDLTRKYGSPGA  519 (741)
Q Consensus       445 ~~RIvGG~~a~~ge~PW~VsL~~~~-~~~~CgGTLIS~rwVLTAAHCv~~~----~~~~~~i~V~lG~~~l~~~~~~~~~  519 (741)
                      ..||+||..+.+++|||||+|+... +.|+|||+||+++|||||||||...    ......+.|++|.+++.... ....
T Consensus       163 ~~RIvgG~~a~~g~~Pw~v~l~~~~~~~~~CGGsLIs~~~VLTAAHCv~~~~~~~~~~~~~~~V~lG~~~~~~~~-~~~~  241 (424)
T 3nxp_A          163 DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYE-RNIE  241 (424)
T ss_dssp             SSCCCCCEECCTTSCTTEEEEEETTTTEEEEEEEESSSSEEEECHHHHEEGGGTEECCGGGEEEEESCCBSSSCC-TTTC
T ss_pred             CCeeECCEECCCCCCCCEEEEeecCCCCccceeEEEcCCEEEEhHHhcCccccccccCcccEEEEeCcccccccC-CCce
Confidence            5699999999999999999998653 4689999999999999999999632    12345789999998865432 2334


Q ss_pred             EEEEEEEEEEecCCC-CCCCCCceEEEEeccccccCCceeEEecCCCCCc---CCCCCeEEEEEecccCC------CCCC
Q psy7302         520 QTLRVATTYIHHNHN-SQTLDNDIALLKLHGQAELKDGVCLVCLPARGVN---HAAGKRCTVTGYGYMGE------AGPI  589 (741)
Q Consensus       520 q~~~V~~IiiHP~Y~-~~t~~nDIALLkL~~pi~~s~~V~PICLP~~~~~---~~~g~~~~v~GWG~t~~------~~~~  589 (741)
                      +.+.|.+|++||+|+ ...+.||||||||++|+.|+++|+|||||.....   ...+..++++|||.+..      ....
T Consensus       242 ~~~~V~~ii~Hp~y~~~~~~~nDIALLkL~~pv~~s~~v~PicLp~~~~~~~~~~~g~~~~v~GWG~t~~~~~~~~~~~~  321 (424)
T 3nxp_A          242 KISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQ  321 (424)
T ss_dssp             EEECEEEEEECTTCBTTTTSBTCCEEEEESSCCCCCSSCCCCBCCCHHHHHHHHHHCSEEEEEESSHHHHHHHHC----C
T ss_pred             eEEEEEEEEeCCCCCCCCCCcCCeEEEEecCccccCCcccccCCCCcccccccccCCCeEEEEecCCCCccCccccCCCC
Confidence            677899999999998 4577899999999999999999999999975432   34688999999997542      1223


Q ss_pred             cceeEEEEEeeeChhHHHHhhccccccccccCCCeEEecCCC----CCCCCCCCCCCceEEee--CCeEEEEEEEecCCC
Q psy7302         590 PLRVREAEIPIVSDTECIRKINAVTEKIFILPASSFCAGGEE----GNDACQGDGGGPLVCQD--DGFYELAGLVSWGFG  663 (741)
Q Consensus       590 s~~L~~~~v~vis~~~C~~~~~~~~~~~~~i~~~~~CAg~~~----g~~~C~GDSGGPLv~~~--~g~~~LvGVvS~G~g  663 (741)
                      +..|+++.+++++.+.|...+..      .+.++||||+...    +.++|+|||||||++..  +++|+|+||+|||. 
T Consensus       322 ~~~L~~~~v~ii~~~~C~~~~~~------~i~~~~iCAg~~~~~~~~~d~C~GDSGGPLv~~~~~~~~~~l~GIvS~G~-  394 (424)
T 3nxp_A          322 PSVLQVVNLPIVERPVCKDSTRI------RITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGE-  394 (424)
T ss_dssp             CSBCEEEEEEBCCHHHHHHTCSS------CCCTTEEEESCCCBTTBCCCTTCSCTTCEEEEECTTTCCEEEEEEECCSS-
T ss_pred             CccceEEEeeEEcHHHhhhhccC------cCCCCeEecccCCCCCCCCccCCCcCCCceEEEECCCCcEEEEEEEEeCC-
Confidence            67899999999999999887632      4678999998642    46999999999999985  66777777766654 


Q ss_pred             CCCCCCCceeeeccccCCCcccCCCCCceEeccCCeEEEEeeeecCCCCCCCCCCeEEEeccchHhHHHHhhccCC
Q psy7302         664 CGRQDVPGVYVKVSSFNGMSKVGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSFIGWINQIISVNN  739 (741)
Q Consensus       664 C~~~~~P~VYtrVS~y~~wI~~~DsGgp~~~~~~~~~~L~GI~S~G~~Cg~~~~P~VYTrVs~y~dWI~~vI~~~n  739 (741)
                                                                     +|+..+.|+|||||+.|++||+++|+..+
T Consensus       395 -----------------------------------------------~C~~~~~pgVyT~Vs~y~~WI~~~i~~~g  423 (424)
T 3nxp_A          395 -----------------------------------------------GCDRDGKYGFYTHVFRLKKWIQKVIDQFG  423 (424)
T ss_dssp             -----------------------------------------------CTTTCCSCEEEEECTTCHHHHHHHHHHHC
T ss_pred             -----------------------------------------------CCCCCCCCEEEEEHHHHHHHHHHHHHHhc
Confidence                                                           45555678999999999999999997643
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>5hpg_A Plasminogen; serine protease, kringle 5, fibrinolysis; 1.66A {Homo sapiens} SCOP: g.14.1.1 PDB: 2knf_A Back     alignment and structure
>1jfn_A APO(A) KIV-T6, apolipoprotein A, KIV-T6, apolipoprotein; kringle domain, protein-protein recognition, LP(A), lipid transport; NMR {Homo sapiens} SCOP: g.14.1.1 Back     alignment and structure
>1i71_A APO(A), apolipoprotein(A); alipoprotein(A), kringle, protein-ligand interaction, lysine binding, hydrolase; 1.45A {Homo sapiens} SCOP: g.14.1.1 PDB: 1kiv_A 3kiv_A 4kiv_A 1krn_A 1pmk_A 2pk4_A 1pk4_A Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1pml_A Tissue plasminogen activator kringle 2; hydrolase(serine protease); 2.38A {Homo sapiens} SCOP: g.14.1.1 PDB: 1pk2_A* 1tpk_A Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3k65_A Prothrombin; coagulation, zymogen, hydrolase; 1.85A {Homo sapiens} PDB: 2hpq_P* 2hpp_P* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3e6p_L Prothrombin; meizothrombin, allostery, linkage, Na+ binding, AC phase, blood coagulation, cleavage on PAIR of basic residue disease mutation; HET: DFK NAG; 2.10A {Homo sapiens} PDB: 1a0h_A* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>2qj2_A Hepatocyte growth factor; HGF/SF, hormone/growth factor; 1.81A {Homo sapiens} SCOP: g.10.1.1 g.14.1.1 PDB: 1nk1_A 3mkp_A* 1gmn_A* 1gmo_A* 1bht_A* 1gp9_A* 2qj4_A Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1nl1_A Prothrombin; hydrolase; HET: CGU NAG; 1.90A {Bos taurus} SCOP: g.14.1.1 g.32.1.1 PDB: 2pf2_A* 2pf1_A* 1nl2_A* 2spt_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 741
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 2e-46
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 2e-46
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 2e-45
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 1e-44
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 3e-44
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 1e-43
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 3e-43
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 8e-43
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-42
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 2e-41
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 2e-41
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 3e-41
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 8e-41
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 1e-40
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 2e-40
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 2e-40
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 6e-40
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 7e-40
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 1e-39
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 2e-39
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 2e-39
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 2e-39
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 3e-39
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 3e-38
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 4e-38
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 9e-38
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 2e-37
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 2e-37
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 3e-37
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 4e-37
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 2e-36
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 5e-36
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 6e-36
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 7e-36
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 8e-36
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 2e-35
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 1e-34
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 2e-34
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 1e-33
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 1e-33
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 2e-33
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 2e-33
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 2e-33
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 8e-33
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 2e-32
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 3e-32
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 3e-32
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 3e-32
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 2e-31
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 3e-31
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 3e-31
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 5e-31
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 2e-30
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-30
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 2e-29
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 5e-25
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-07
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 1e-24
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 6e-22
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 8e-12
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 3e-06
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 9e-11
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 3e-06
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 6e-05
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: beta-Tryptase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  163 bits (412), Expect = 2e-46
 Identities = 82/238 (34%), Positives = 125/238 (52%), Gaps = 11/238 (4%)

Query: 448 VVGGEDADPAEWCWQVALI--NSLNQYLCGGALIGTQWVLTAAHCVTNIVRSGDAVYVRV 505
           +VGG++A  ++W WQV+L        + CGG+LI  QWVLTAAHCV   V+   A+ V++
Sbjct: 1   IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQL 60

Query: 506 GDHDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELKDGVCLVCLPAR 565
            +  L  +      Q L V+   +H    +  +  DIALL+L    ++   V  V LP  
Sbjct: 61  REQHLYYQD-----QLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPA 115

Query: 566 GVNHAAGKRCTVTGYGYM--GEAGPIPLRVREAEIPIVSDTECIRK--INAVTEKIFILP 621
                 G  C VTG+G +   E  P P  +++ ++PI+ +  C  K  + A T     + 
Sbjct: 116 SETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIV 175

Query: 622 ASSFCAGGEEGNDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKVSSF 679
                  G    D+CQGD GGPLVC+ +G +  AG+VSWG GC + + PG+Y +V+ +
Sbjct: 176 RDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYY 233
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query741
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 100.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 100.0
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 100.0
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 100.0
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 100.0
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 100.0
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1elva1259 Complement C1S protease, catalytic domain {Human ( 100.0
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 100.0
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 100.0
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 100.0
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 100.0
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 100.0
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 100.0
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 100.0
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 100.0
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 100.0
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 100.0
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 100.0
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 100.0
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 100.0
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 100.0
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 100.0
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 100.0
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 100.0
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 100.0
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 100.0
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 100.0
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 100.0
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 100.0
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 100.0
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 100.0
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 100.0
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 100.0
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 100.0
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 100.0
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 100.0
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 100.0
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 100.0
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.88
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.88
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.55
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.55
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.53
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.16
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 98.69
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 98.69
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.6
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 98.49
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.29
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 98.16
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 98.1
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 97.91
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 97.73
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 97.55
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 97.39
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 97.38
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 97.37
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 97.34
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 97.19
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 96.9
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 96.81
d1elva1259 Complement C1S protease, catalytic domain {Human ( 96.54
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 96.21
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 96.18
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 95.7
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 95.23
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 93.38
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 92.55
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 91.37
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 90.42
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 89.8
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 88.1
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 86.38
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 86.32
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 86.14
d2hpqp_79 Meizothrombin {Human (Homo sapiens) [TaxId: 9606]} 85.47
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 85.37
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 84.78
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 84.37
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 84.36
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 84.16
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 84.0
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 83.95
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 83.8
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 83.72
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 83.5
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 83.4
d1i71a_83 Apolipoprotein A {Human (Homo sapiens), IV-7 varia 83.34
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 83.18
d1ki0a287 Plasminogen {Human (Homo sapiens) [TaxId: 9606]} 83.0
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 82.58
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 82.53
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 82.44
d1nl1a182 Prothrombin {Cow (Bos taurus) [TaxId: 9913]} 82.35
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 81.39
d1ki0a183 Plasminogen {Human (Homo sapiens) [TaxId: 9606]} 81.13
d2qj2a283 NK1 fragment of hepatocyte growth factor {Human (H 80.5
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hpqp_ g.14.1.1 (P:) Meizothrombin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i71a_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-7 variant [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki0a2 g.14.1.1 (A:164-250) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1nl1a1 g.14.1.1 (A:66-147) Prothrombin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki0a1 g.14.1.1 (A:81-163) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qj2a2 g.14.1.1 (A:127-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure