Diaphorina citri psyllid: psy7307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
ccccccccEEEcccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEcccccccccEEEEccccHHHHHHccccccccccccccccccEEEEEEccccccccccccc
**LCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS

Function Prediction

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0070011 [MF]peptidase activity, acting on L-amino acid peptidesprobableGO:0016787, GO:0008233, GO:0003674, GO:0003824
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XRC, chain A
Confidence level:very confident
Coverage over the Query: 20-82
View the alignment between query and template
View the model in PyMOL
Template: 1Z8G, chain A
Confidence level:very confident
Coverage over the Query: 3-88
View the alignment between query and template
View the model in PyMOL
Template: 1YPH, chain E
Confidence level:very confident
Coverage over the Query: 47-113
View the alignment between query and template
View the model in PyMOL