Psyllid ID: psy7307


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
ccccccccEEEcccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEcccccccccEEEEccccHHHHHHHcccccccccccccccccEEEEEEccccccccccccc
ccHHHHEEEEHccccccccccEEccccccEccccccccEEEEEcccccEEEEEEEEEcccccccccEEHHHHHHHHHHHEccccccccEEEEEcccccEEEEEEEEEccccccEccc
MSLCLVLVLICAAHQLVRADYdvfnrtsrqaqtgdsggplllqrpdkqwtIIGVVSwgigcgktpgvYVQVNKYLRWIYNtakgdsggplllqrpdkqwtIIGVVSWGIGCAQVLKS
MSLCLVLVLICAAHQLVRADYDVFNRTSrqaqtgdsggplllqRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
**LCLVLVLICAAHQLVRADYDVFNR*************LLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVL**
***CLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAK**************QWTIIGVVSWGIGCAQV***
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
*SLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVL*S
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLCLVLVLICAAHQLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKGDSGGPLLLQRPDKQWTIIGVVSWGIGCAQVLKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
UNIPROTKB|F1PXI5 581 PRSS42 "Uncharacterized protei 0.529 0.106 0.384 1.3e-16
RGD|13095811061 Tmprss9 "transmembrane proteas 0.393 0.043 0.520 2.2e-08
UNIPROTKB|Q7Z410 1059 TMPRSS9 "Transmembrane proteas 0.384 0.042 0.489 1e-15
UNIPROTKB|F1NP62 983 F1NP62 "Uncharacterized protei 0.384 0.045 0.510 1.1e-15
UNIPROTKB|I3LDL1 1047 TMPRSS9 "Uncharacterized prote 0.384 0.042 0.489 2.6e-15
UNIPROTKB|F1SNW6591 F1SNW6 "Uncharacterized protei 0.376 0.074 0.510 7.3e-08
UNIPROTKB|E1B9Z91095 TMPRSS9 "Uncharacterized prote 0.393 0.042 0.479 2.7e-07
UNIPROTKB|F1SUG2 632 PRSS22 "Uncharacterized protei 0.418 0.077 0.442 1.5e-13
UNIPROTKB|E7ESG9290 TMPRSS4 "Transmembrane proteas 0.427 0.172 0.574 5.7e-13
UNIPROTKB|I3L9G9655 I3L9G9 "Uncharacterized protei 0.470 0.083 0.457 4.8e-07
UNIPROTKB|F1PXI5 PRSS42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 1.3e-16, Sum P(2) = 1.3e-16
 Identities = 25/65 (38%), Positives = 38/65 (58%)

Query:    24 FNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGK--TPGVYVQVNKYLRWIYNT 81
             +    + +  GDSGGPL+ +  D  W  +G+VSWG GCG+   PGVY  +  Y  WI + 
Sbjct:   186 YKAAGKDSCQGDSGGPLVCKFQDT-WVQVGIVSWGFGCGRRNVPGVYTDIASYAEWIDSR 244

Query:    82 AKGDS 86
              +G++
Sbjct:   245 VRGEA 249


GO:0006508 "proteolysis" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
RGD|1309581 Tmprss9 "transmembrane protease, serine 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z410 TMPRSS9 "Transmembrane protease serine 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP62 F1NP62 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDL1 TMPRSS9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNW6 F1SNW6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9Z9 TMPRSS9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUG2 PRSS22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7ESG9 TMPRSS4 "Transmembrane protease serine 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9G9 I3L9G9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 2e-15
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 8e-15
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 3e-09
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 3e-09
pfam00089218 pfam00089, Trypsin, Trypsin 6e-09
COG5640413 COG5640, COG5640, Secreted trypsin-like serine pro 6e-07
pfam00089218 pfam00089, Trypsin, Trypsin 7e-04
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score = 69.2 bits (170), Expect = 2e-15
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 34  GDSGGPLLLQRPDKQWTIIGVVSWGIGCGK--TPGVYVQVNKYLRWIYNT 81
           GDSGGPL+      +  ++G+VSWG GC +   PGVY +V+ YL WI  T
Sbjct: 184 GDSGGPLVCNDNG-RGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT 232


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
KOG3627|consensus256 99.35
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.09
COG5640413 Secreted trypsin-like serine protease [Posttransla 99.07
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 98.79
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 98.61
KOG3627|consensus256 98.48
COG5640 413 Secreted trypsin-like serine protease [Posttransla 97.94
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 97.63
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 97.41
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 96.54
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 93.73
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 86.57
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 85.73
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 83.2
>KOG3627|consensus Back     alignment and domain information
Probab=99.35  E-value=4.4e-12  Score=87.52  Aligned_cols=80  Identities=34%  Similarity=0.706  Sum_probs=62.1

Q ss_pred             eeeeccccccCCcc-----cccceeecC-CCCCCcccCCCCCeeEEEcCCCcEEEEEEeecCCC-CCC--CCceeeeccc
Q psy7307           3 LCLVLVLICAAHQL-----VRADYDVFN-RTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIG-CGK--TPGVYVQVNK   73 (117)
Q Consensus         3 ~~~~~~~~C~~~~~-----~~~~~~~~~-~~~~~~C~~dsG~pl~~~~~~~~~~~vgI~s~~~~-C~~--~p~~~t~v~~   73 (117)
                      +.+.+...|.....     ....+|+.. ...+++|+||+|+||++.... +++++||+||+.. |..  .|++|+++..
T Consensus       167 v~i~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~-~~~~~GivS~G~~~C~~~~~P~vyt~V~~  245 (256)
T KOG3627|consen  167 VPIISNSECRRAYGGLGTITDTMLCAGGPEGGKDACQGDSGGPLVCEDNG-RWVLVGIVSWGSGGCGQPNYPGVYTRVSS  245 (256)
T ss_pred             EeEcChhHhcccccCccccCCCEEeeCccCCCCccccCCCCCeEEEeeCC-cEEEEEEEEecCCCCCCCCCCeEEeEhHH
Confidence            45556666765322     223477776 567889999999999998533 7999999999966 987  7999999999


Q ss_pred             chHHHHhhcc
Q psy7307          74 YLRWIYNTAK   83 (117)
Q Consensus        74 ~~~wi~~~~~   83 (117)
                      |.+||++...
T Consensus       246 y~~WI~~~~~  255 (256)
T KOG3627|consen  246 YLDWIKENIG  255 (256)
T ss_pred             hHHHHHHHhc
Confidence            9999988653



>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 4e-20
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 2e-12
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 2e-19
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 4e-12
1md8_A329 C1R complement serine protease; innate immunity, a 5e-19
1md8_A329 C1R complement serine protease; innate immunity, a 3e-10
1gpz_A399 Complement C1R component; hydrolase, activation, i 6e-19
1gpz_A399 Complement C1R component; hydrolase, activation, i 3e-10
2qy0_B242 Complement C1R subcomponent; serine protease, beta 8e-19
2qy0_B242 Complement C1R subcomponent; serine protease, beta 2e-10
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 9e-19
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 2e-11
1elv_A333 Complement C1S component; trypsin-like serin prote 2e-18
1elv_A333 Complement C1S component; trypsin-like serin prote 1e-09
2xrc_A565 Human complement factor I; immune system, hydrolas 4e-18
2xrc_A565 Human complement factor I; immune system, hydrolas 3e-11
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 5e-18
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 2e-11
2jde_A276 Urokinase-type plasminogen activator; plasminogen 1e-17
2jde_A276 Urokinase-type plasminogen activator; plasminogen 7e-09
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 2e-17
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 1e-10
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 2e-17
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 2e-10
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 2e-17
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 1e-10
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 2e-17
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 3e-10
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 2e-17
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 3e-10
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 2e-17
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 2e-09
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 4e-17
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 1e-10
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 4e-17
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 2e-09
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 5e-17
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 6e-10
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 6e-17
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 1e-09
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 6e-17
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 8e-10
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 8e-17
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 1e-09
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 8e-17
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 3e-09
1aut_C250 Activated protein C; serine proteinase, plasma cal 1e-16
1aut_C250 Activated protein C; serine proteinase, plasma cal 2e-09
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 2e-16
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 1e-08
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 2e-16
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 1e-09
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 2e-16
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 3e-09
2r0l_A248 Hepatocyte growth factor activator; serine proteas 2e-16
2r0l_A248 Hepatocyte growth factor activator; serine proteas 1e-08
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 2e-16
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 6e-09
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 3e-16
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 6e-09
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 7e-16
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 2e-08
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 9e-16
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 3e-06
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 1e-15
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 2e-08
3bg8_A238 Coagulation factor XIA light chain; protease inhib 1e-15
3bg8_A238 Coagulation factor XIA light chain; protease inhib 7e-09
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-15
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 2e-06
1a7s_A225 Heparin binding protein; serine protease homolog, 1e-15
1a7s_A225 Heparin binding protein; serine protease homolog, 4e-06
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 1e-15
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 3e-06
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 1e-15
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 2e-08
1euf_A227 Duodenase; serine protease, dual specificity, hydr 1e-15
1euf_A227 Duodenase; serine protease, dual specificity, hydr 7e-06
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 1e-15
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 8e-09
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 2e-15
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 1e-08
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 2e-15
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 5e-06
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 2e-15
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 1e-08
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 2e-15
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 2e-09
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 2e-15
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 3e-09
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 2e-15
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 3e-08
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 3e-15
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 1e-07
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 3e-15
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 3e-05
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 4e-15
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 2e-08
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 4e-15
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 1e-08
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 4e-15
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 1e-07
2asu_B234 Hepatocyte growth factor-like protein; serine prot 7e-15
2asu_B234 Hepatocyte growth factor-like protein; serine prot 4e-08
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 8e-15
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 2e-08
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 1e-14
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 6e-09
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 1e-14
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 1e-07
2xxl_A408 GRAM-positive specific serine protease, isoform B; 2e-14
2xxl_A408 GRAM-positive specific serine protease, isoform B; 2e-07
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 2e-14
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 7e-08
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 2e-14
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 4e-08
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 4e-14
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 2e-07
3hrz_D741 Complement factor B; serine protease, glycosilated 8e-14
3hrz_D741 Complement factor B; serine protease, glycosilated 2e-08
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 9e-14
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 3e-06
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 1e-13
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 6e-07
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 1e-13
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 9e-07
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 2e-13
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 5e-07
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 2e-13
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 6e-06
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 3e-13
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 2e-06
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 3e-13
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 3e-06
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 3e-13
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 4e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-13
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-06
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 4e-13
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 4e-06
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 4e-13
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 4e-06
1ao5_A237 Glandular kallikrein-13; serine protease, protein 4e-13
1ao5_A237 Glandular kallikrein-13; serine protease, protein 4e-06
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 4e-13
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 6e-06
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 5e-13
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 6e-07
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 6e-13
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 2e-05
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 7e-13
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 6e-06
1azz_A226 Collagenase; complex (serine protease/inhibitor), 7e-13
1azz_A226 Collagenase; complex (serine protease/inhibitor), 3e-05
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 8e-13
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 7e-06
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 9e-13
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 2e-05
2aiq_A231 Protein C activator; snake venom serine proteinase 1e-12
2aiq_A231 Protein C activator; snake venom serine proteinase 3e-05
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 1e-12
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 1e-05
2xw9_A228 Complement factor D; immune system, hydrolase, ser 1e-12
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-05
2z7f_E218 Leukocyte elastase; serine protease, serine protea 1e-12
2z7f_E218 Leukocyte elastase; serine protease, serine protea 2e-05
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 2e-12
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 7e-06
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 2e-12
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 3e-05
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 2e-12
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 2e-05
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 2e-12
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 7e-06
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 2e-12
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-05
2odp_A509 Complement C2; C3/C5 convertase, complement serin 9e-12
2odp_A509 Complement C2; C3/C5 convertase, complement serin 1e-07
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-11
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 6e-05
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 6e-11
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 7e-04
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 4e-05
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 7e-05
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 4e-04
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
 Score = 81.6 bits (202), Expect = 4e-20
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 34  GDSGGPLLLQRPDKQWTIIGVVSWGIGCGK--TPGVYVQVNKYLRWIYNT 81
           GDSGGPLL +R ++Q+ + G+VS+G  CG    PG+Y +V KY  WI   
Sbjct: 226 GDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRDWIEGN 275


>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.71
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.67
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.62
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.61
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.6
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.58
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.58
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.57
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.57
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.57
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.57
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.57
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.57
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.57
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.57
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.57
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.57
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.57
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.57
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.56
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.56
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.56
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.56
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.55
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.55
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.55
1md8_A329 C1R complement serine protease; innate immunity, a 99.55
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.55
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.55
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.55
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.54
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.54
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.54
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.54
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.53
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.53
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.52
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.52
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.52
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.52
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.51
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.51
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.51
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.51
1elv_A333 Complement C1S component; trypsin-like serin prote 99.49
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.47
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.46
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.46
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.45
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.45
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.45
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.45
2xrc_A565 Human complement factor I; immune system, hydrolas 99.44
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.44
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.44
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.43
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.43
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.43
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.43
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.43
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.42
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.42
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.41
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.41
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.41
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.41
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.41
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.4
2aiq_A231 Protein C activator; snake venom serine proteinase 99.4
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.4
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.4
1a7s_A225 Heparin binding protein; serine protease homolog, 99.4
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.39
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.39
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.39
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.39
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.39
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.39
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.38
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.38
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.38
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.37
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.35
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.35
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.35
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.34
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.33
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.31
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.3
3hrz_D741 Complement factor B; serine protease, glycosilated 99.3
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.29
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.29
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.24
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.2
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.08
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 98.94
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.91
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 98.9
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 98.85
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 98.84
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 98.83
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 98.81
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 98.78
1aut_C250 Activated protein C; serine proteinase, plasma cal 98.77
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 98.75
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 98.74
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 98.74
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 98.74
2asu_B234 Hepatocyte growth factor-like protein; serine prot 98.72
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 98.71
2jde_A276 Urokinase-type plasminogen activator; plasminogen 98.71
1gpz_A399 Complement C1R component; hydrolase, activation, i 98.71
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 98.7
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 98.7
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 98.7
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 98.69
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 98.69
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 98.68
1elv_A333 Complement C1S component; trypsin-like serin prote 98.66
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.66
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 98.65
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 98.64
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 98.63
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 98.62
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 98.62
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 98.61
3bg8_A238 Coagulation factor XIA light chain; protease inhib 98.6
2qy0_B242 Complement C1R subcomponent; serine protease, beta 98.59
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 98.56
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 98.56
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 98.55
1md8_A329 C1R complement serine protease; innate immunity, a 98.54
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 98.54
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 98.53
2r0l_A248 Hepatocyte growth factor activator; serine proteas 98.53
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 98.53
2xrc_A565 Human complement factor I; immune system, hydrolas 98.52
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 98.51
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 98.51
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 98.5
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 98.49
2xxl_A408 GRAM-positive specific serine protease, isoform B; 98.46
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 98.45
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 98.45
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 98.45
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 98.44
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 98.44
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 98.43
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 98.43
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 98.42
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 98.42
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 98.42
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 98.41
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 98.41
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 98.41
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 98.41
1ao5_A237 Glandular kallikrein-13; serine protease, protein 98.4
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 98.4
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 98.4
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 98.39
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 98.38
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 98.37
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 98.37
2odp_A509 Complement C2; C3/C5 convertase, complement serin 98.36
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 98.36
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.35
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 98.33
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 98.32
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 98.31
2aiq_A231 Protein C activator; snake venom serine proteinase 98.27
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 98.27
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 98.24
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 98.23
3hrz_D741 Complement factor B; serine protease, glycosilated 98.22
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 98.21
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 98.2
1a7s_A225 Heparin binding protein; serine protease homolog, 98.18
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 98.18
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 98.18
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 98.17
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 98.13
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 98.13
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 98.13
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 98.08
2z7f_E218 Leukocyte elastase; serine protease, serine protea 98.07
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 98.07
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.03
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 98.01
2o8l_A274 V8 protease, taphylococcal serine; serine protease 98.01
1azz_A226 Collagenase; complex (serine protease/inhibitor), 97.99
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 97.98
2xw9_A228 Complement factor D; immune system, hydrolase, ser 97.92
1euf_A227 Duodenase; serine protease, dual specificity, hydr 97.88
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 97.85
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 97.84
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 97.82
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 97.82
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 97.81
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 97.73
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 97.68
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.67
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 97.57
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 97.55
2o8l_A274 V8 protease, taphylococcal serine; serine protease 97.46
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 97.45
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 97.26
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 97.1
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 97.01
1hpg_A187 Glutamic acid specific protease; serine protease, 96.81
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 96.79
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 96.74
1hpg_A187 Glutamic acid specific protease; serine protease, 96.66
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 96.66
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 96.58
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 96.35
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 96.31
2oua_A188 Serine protease, protein NAPA; kinetic stability, 96.06
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 96.04
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 95.21
3k6y_A237 Serine protease, possible membrane-associated seri 94.1
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 93.84
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 93.76
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 93.34
2oua_A188 Serine protease, protein NAPA; kinetic stability, 93.09
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 92.83
3k6y_A237 Serine protease, possible membrane-associated seri 92.8
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 92.53
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 91.81
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 91.58
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 91.05
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 91.01
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 90.95
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 90.73
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 90.71
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 90.01
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 89.66
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 88.92
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 88.36
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 88.01
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 87.63
3syj_A 1011 Adhesion and penetration protein autotransporter; 87.6
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 85.91
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 85.18
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 83.2
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
Probab=99.71  E-value=9.1e-18  Score=99.98  Aligned_cols=79  Identities=33%  Similarity=0.625  Sum_probs=61.9

Q ss_pred             eeeeccccccCC---cccccceeecCCCCCCcccCCCCCeeEEEcCCCcEEEEEEeecCCCCCC--CCceeeecccchHH
Q psy7307           3 LCLVLVLICAAH---QLVRADYDVFNRTSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGIGCGK--TPGVYVQVNKYLRW   77 (117)
Q Consensus         3 ~~~~~~~~C~~~---~~~~~~~~~~~~~~~~~C~~dsG~pl~~~~~~~~~~~vgI~s~~~~C~~--~p~~~t~v~~~~~w   77 (117)
                      +.+.+...|...   .+....+|+. ..++++|+||+|+||++.. .++|+++||+||+..|..  .|++||++..|.+|
T Consensus        12 v~i~~~~~C~~~~~~~i~~~~iCa~-~~~~~~C~GDSGGPL~~~~-~~~~~l~GIvS~g~~c~~~~~p~vyt~V~~y~~W   89 (97)
T 1yph_E           12 LPLLSNTNCKKYWGTKIKDAMICAG-ASGVSSCMGDSGGPLVCKK-NGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNW   89 (97)
T ss_dssp             EEBCCHHHHHHHHGGGCCTTEEEEE-CSSCBCCTTCTTCEEEEEE-TTEEEEEEEEEECCTTCCTTSEEEEEEHHHHHHH
T ss_pred             EEECCHHHhhHHhcCCCCCceEeec-CCCCCCCcCCCCCcEEEEe-CCeEEEEEEEEeCCCCCCCCCCeEEEEHHHhHHH
Confidence            556666667532   2344556776 3467899999999999874 678999999999977764  89999999999999


Q ss_pred             HHhhcc
Q psy7307          78 IYNTAK   83 (117)
Q Consensus        78 i~~~~~   83 (117)
                      |++.++
T Consensus        90 I~~~~~   95 (97)
T 1yph_E           90 VQQTLA   95 (97)
T ss_dssp             HHHHHH
T ss_pred             HHHHHc
Confidence            998764



>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 2e-12
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 3e-06
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 5e-12
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 1e-05
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 6e-12
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 5e-06
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 6e-12
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 1e-05
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 7e-12
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 4e-04
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 1e-11
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 4e-04
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 1e-11
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 9e-06
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 1e-11
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 7e-06
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 2e-11
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 7e-05
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 2e-11
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 8e-07
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-11
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-04
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 3e-11
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 5e-11
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 3e-04
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 7e-11
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 0.002
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 8e-11
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 0.003
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 8e-11
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 2e-04
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 8e-11
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 1e-10
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 0.002
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 2e-10
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 0.004
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 2e-10
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 3e-04
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 2e-10
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 0.004
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 3e-10
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 2e-04
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 4e-10
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 0.001
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 5e-10
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 6e-04
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 7e-10
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 5e-04
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 7e-10
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 5e-04
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 8e-10
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 5e-04
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 8e-10
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 7e-04
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 9e-10
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 0.002
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 1e-09
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 8e-04
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 1e-09
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-09
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 0.002
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 3e-09
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 0.004
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 3e-09
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 2e-04
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 4e-09
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 1e-08
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 2e-08
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 3e-08
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 4e-08
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 7e-04
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 5e-08
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 6e-08
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 6e-08
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 7e-08
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 7e-08
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 8e-08
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 1e-07
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-07
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 1e-07
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 1e-07
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 2e-07
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 3e-07
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 3e-07
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 7e-07
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 7e-07
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 9e-07
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 2e-06
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 3e-06
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 7e-06
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 1e-05
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 2e-04
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.36
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.32
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.32
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.3
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.3
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.29
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.28
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.28
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.28
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.27
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.27
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.27
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.27
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.26
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.25
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.24
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.24
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.24
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.24
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.23
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.22
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.22
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.21
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.21
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.2
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.2
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.17
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.17
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.15
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.15
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.15
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.14
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.14
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.12
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.11
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.11
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.1
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.1
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.08
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.07
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.06
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.01
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 98.98
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 98.9
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 98.9
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 98.57
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 98.21
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 98.18
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 98.12
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 98.11
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 98.11
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 98.09
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.08
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 98.08
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 98.01
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.01
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 98.0
d1elva1259 Complement C1S protease, catalytic domain {Human ( 97.98
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 97.97
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 97.97
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 97.96
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 97.95
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 97.94
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 97.92
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 97.91
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 97.86
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.85
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 97.85
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 97.84
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.82
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 97.79
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.76
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 97.76
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 97.75
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 97.74
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 97.72
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 97.71
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 97.7
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 97.64
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 97.64
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 97.58
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 97.55
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 97.55
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 97.53
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 97.49
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 97.39
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 97.39
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 97.38
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 97.3
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 97.28
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 97.25
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 97.21
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 97.19
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 97.09
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 97.03
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 97.01
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 96.94
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 96.25
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 96.17
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 94.48
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 93.89
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 92.66
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 88.45
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 87.93
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 87.48
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 84.7
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 83.19
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 82.79
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Factor B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.44  E-value=6.9e-14  Score=95.36  Aligned_cols=61  Identities=26%  Similarity=0.676  Sum_probs=49.3

Q ss_pred             CCCCcccCCCCCeeEEEcCCCcEEEEEEeecCC--CCCC----------CCceeeecccchHHHHhhccCCCCC
Q psy7307          27 TSRQAQTGDSGGPLLLQRPDKQWTIIGVVSWGI--GCGK----------TPGVYVQVNKYLRWIYNTAKGDSGG   88 (117)
Q Consensus        27 ~~~~~C~~dsG~pl~~~~~~~~~~~vgI~s~~~--~C~~----------~p~~~t~v~~~~~wi~~~~~gdsg~   88 (117)
                      .+.++|.||||+||+++. .++|+++||+||+.  .|..          .|.+|+++..|.+||+++++++.-+
T Consensus       213 ~~~~~C~GDSGgPL~~~~-~~~~~lvGI~S~G~~~~~~~~~~~~~~~~~~~~vyt~V~~y~~WI~~~i~~~~~~  285 (287)
T d1rrka1         213 ADPNTCRGDSGGPLIVHK-RSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG  285 (287)
T ss_dssp             CCCCCCGGGTTCEEEEEE-TTEEEEEEEEEEESCCCC--------CCTTCEEEEEEGGGGHHHHHHHTTTSSCC
T ss_pred             cCCCCCCCCccCCeEEec-CCeEEEEEEEEecCCcCcCCCCCCCcCCCCCCcEEEEHHHHHHHHHHHhcCCCCC
Confidence            457889999999999874 67899999999853  2321          4678999999999999999877644



>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure