Diaphorina citri psyllid: psy7332


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEGAAVPCSVLFSNFIVILSPPGLLLFLKYWGMIWF
cccccccccEEEEEEECccccEEEEECcccccccccccccccccccccccEEEEcccccEEEEEEccEEcc
MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEGAAVPCSVLFSNFIVILSPPGLLLFLKYWGMIWF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEGAAVPCSVLFSNFIVILSPPGLLLFLKYWGMIWF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase 2C homolog 3 Has an important role in osmotic stability and cell shape control. It may negatively regulate the osmosensing signal transmitted through wis1 map kinase.confidentQ09173
Probable protein phosphatase 2C 21 confidentO81716
Probable protein phosphatase 2C 58 confidentQ67UP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006470 [BP]protein dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0004722 [MF]protein serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0009737 [BP]response to abscisic acid stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I0O, chain A
Confidence level:very confident
Coverage over the Query: 1-69
View the alignment between query and template
View the model in PyMOL