Score = 43.5 bits (101), Expect = 4e-04, Method: Composition-based stats.
Identities = 20/39 (51%), Positives = 24/39 (61%)
Query: 1 MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEGA 39
MG LS+P+T+K S N + G SSMQGWRI E A
Sbjct: 1 MGQTLSEPVTEKHSVNGSNEFVLYGLSSMQGWRISMEDA 39
Has an important role in osmotic stability and cell shape control. It may negatively regulate the osmosensing signal transmitted through wis1 map kinase.
pyruvate dehydrogenase (lipoamide)-phosphatase (3.1.3.43 from EC), adenylate cyclase (4.6.1.1 from EC) and some bacterial stage II sporulation E proteins (3.1.3.16 from EC). Protein phosphatase 2C (PP2C) is one of the four major classes of mammalian serine/threonine specific protein phosphatases (3.1.3.16 from EC). PP2C [] is a monomeric enzyme of about 42 Kd which shows broad substrate specificity and is dependent on divalent cations (mainly manganese and magnesium) for its activity. Its exact physiological role is still unclear. Three isozymes are currently known in mammals: PP2C-alpha, -beta and -gamma. In yeast, there are at least four PP2C homologs: phosphatase PTC1 [], which has weak tyrosine phosphatase activity in addition to its activity on serines, phosphatases PTC2 and PTC3, and hypothetical protein YBR125c. Isozymes of PP2C are also known from Arabidopsis thaliana (ABI1, PPH1), Caenorhabditis elegans (FEM-2, F42G9.1, T23F11.1), Leishmania chagasi and Paramecium tetraurelia. In A. thaliana, the kinase associated protein phosphatase (KAPP) [] is an enzyme that dephosphorylates the Ser/Thr receptor-like kinase RLK5 and which contains a C-terminal PP2C domain. PP2C does not seem to be evolutionary related to the main family of serine/ threonine phosphatases: PP1, PP2A and PP2B. However, it is significantly similar to the catalytic subunit of pyruvate dehydrogenase phosphatase 3.1.3.43 from EC (PDPC) [], which catalyzes dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex. PDPC is a mitochondrial enzyme and, like PP2C, is magnesium-dependent.; GO: 0003824 catalytic activity; PDB: 2I0O_A 2POP_C 2POM_A 2J4O_A 2I44_B 3MQ3_A 3N3C_A 2PNQ_B 2P8E_A 2IQ1_A ....
>cd00143 PP2Cc Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity
The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.
>PRK14559 putative protein serine/threonine phosphatase; Provisional
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae} Length = 304
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii} Length = 377
>2i0o_A Ser/Thr phosphatase; beta sandwich, structural genomics, PSI, protei structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Anopheles gambiae}
>3d8k_A PP2C, protein phosphatase 2C; nysgrc, PSI-II, STR genomics, protein structure initiative, NEW YORK structural research consortium, nysgxrc; 2.71A {Toxoplasma gondii}
>2iq1_A Protein phosphatase 2C kappa, PPM1K; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Homo sapiens}