Diaphorina citri psyllid: psy7353


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MSVRGLNLFRYASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSVFNKDI
ccccccHHHHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHHHccccccc
***RGLNLFRYASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDF**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVRGLNLFRYASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSVFNKDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein tramtrack, alpha isoform Binds to a number of sites in the transcriptional regulatory region of ftz. Isoform alpha is required to repress genes that promote the R7 cell fate. Probable repressor of the transcription of the segmentation genes ftz, eve, h, odd, run, and en. May bind to the region 5'-AGGG[CT]GG-3'. Degradation of ttk is directed by binding of sinah or sina, via the adapter molecule phyl which binds to the BTB domain of ttk.confidentP42282

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0035001 [BP]dorsal trunk growth, open tracheal systemprobableGO:0032502, GO:0007424, GO:0060560, GO:0040007, GO:0048589, GO:0060541, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0044707
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0002121 [BP]inter-male aggressive behaviorprobableGO:0050896, GO:0007610, GO:0008150, GO:0002118, GO:0051705, GO:0051704
GO:0048854 [BP]brain morphogenesisprobableGO:0032502, GO:0009887, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0048053 [BP]R1/R6 developmentprobableGO:0048749, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0042462, GO:0046530, GO:0042461, GO:0048869, GO:0048513, GO:0048666, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0048731, GO:0044767, GO:0008150, GO:0048052, GO:0001754, GO:0022008, GO:0001751, GO:0001745, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0032502, GO:0001654
GO:0016476 [BP]regulation of embryonic cell shapeprobableGO:0022604, GO:0051239, GO:0022603, GO:0050793, GO:0051128, GO:0008150, GO:0008360, GO:2000026, GO:0045995, GO:0065007, GO:0065008, GO:0050789, GO:0050794
GO:0035151 [BP]regulation of tube size, open tracheal systemprobableGO:0035150, GO:0007424, GO:0035152, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0090066, GO:0008150, GO:0065007, GO:0048731, GO:0065008, GO:0032502, GO:0007275, GO:0044699
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001709 [BP]cell fate determinationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0048750 [BP]compound eye corneal lens morphogenesisprobableGO:0032502, GO:0048749, GO:0009887, GO:0001745, GO:0044707, GO:0007423, GO:0032501, GO:0048592, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0009653, GO:0048058, GO:0044699
GO:0007298 [BP]border follicle cell migrationprobableGO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0031987 [BP]locomotion involved in locomotory behaviorprobableGO:0040011, GO:0007626, GO:0044708, GO:0050896, GO:0007610, GO:0008150
GO:0046843 [BP]dorsal appendage formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001964 [BP]startle responseprobableGO:0032501, GO:0044707, GO:0009605, GO:0050877, GO:0050896, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0035147 [BP]branch fusion, open tracheal systemprobableGO:0035146, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0032502, GO:0048731
GO:0040003 [BP]chitin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0042675 [BP]compound eye cone cell differentiationprobableGO:0048749, GO:0032502, GO:0009887, GO:0009653, GO:0044707, GO:0007423, GO:0048869, GO:0048592, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0001654, GO:0009987, GO:0001745, GO:0032501, GO:0007275, GO:0044699, GO:0048856

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RPC, chain A
Confidence level:very confident
Coverage over the Query: 12-137
View the alignment between query and template
View the model in PyMOL