Diaphorina citri psyllid: psy7378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK
ccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHccccEEECccccccccccccccccc
**NWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNY****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative ribosomal RNA methyltransferase NOP2 May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation. May act as ribosomal RNA methyltransferase.confidentQ922K7
Putative ribosomal RNA methyltransferase Nop2 Required for 60S ribosomal subunit synthesis. May act as ribosomal RNA methyltransferase.confidentP40991
Putative ribosomal RNA methyltransferase nop2 Required for 60S ribosomal subunit synthesis. May act as ribosomal RNA methyltransferase.confidentO94268

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008173 [MF]RNA methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030687 [CC]preribosome, large subunit precursorprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3M6W, chain A
Confidence level:very confident
Coverage over the Query: 13-75
View the alignment between query and template
View the model in PyMOL