Psyllid ID: psy7378

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK
ccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHccccEEEEccccccccccccccccc
ccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccEEccHHHHHHHHHHHHHcccEEEcccccccccccccccccc
msnwypldSTLALRALSTIGKTSLIVILEAIDclnarsptggylvystcsilpeenEAVVNYALRkrdvklvptgldfgtegfvnyrqnk
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKrdvklvptgldfgtegfvnyrqnk
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK
***WYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNY****
**NWYP*DSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNY****
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK
**NWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNY****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNWYPLDSTLALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNYRQNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
P46087 812 Putative ribosomal RNA me yes N/A 0.722 0.080 0.661 1e-19
Q922K7 793 Putative ribosomal RNA me yes N/A 0.722 0.081 0.646 8e-19
O94268608 Putative ribosomal RNA me yes N/A 0.855 0.126 0.525 7e-17
P40991618 Putative ribosomal RNA me yes N/A 0.722 0.105 0.560 2e-13
P45679430 Ribosomal RNA small subun yes N/A 0.6 0.125 0.418 0.0001
A9MN78429 Ribosomal RNA small subun N/A N/A 0.522 0.109 0.5 0.0002
Q6D000429 Ribosomal RNA small subun yes N/A 0.522 0.109 0.458 0.0003
Q9V106311 tRNA (cytosine(49)-C(5))- no N/A 0.444 0.128 0.525 0.0005
>sp|P46087|NOP2_HUMAN Putative ribosomal RNA methyltransferase NOP2 OS=Homo sapiens GN=NOP2 PE=1 SV=2 Back     alignment and function desciption
 Score = 95.1 bits (235), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 53/65 (81%)

Query: 26  VILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVN 85
           ++L AID +NA S TGGYLVY TCSI  EENE VV+YAL+KR+V+LVPTGLDFG EGF  
Sbjct: 494 LLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTR 553

Query: 86  YRQNK 90
           +R+ +
Sbjct: 554 FRERR 558
May play a role in the regulation of the cell cycle and the increased nucleolar activity that is associated with the cell proliferation. May act as ribosomal RNA methyltransferase.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q922K7|NOP2_MOUSE Putative ribosomal RNA methyltransferase NOP2 OS=Mus musculus GN=Nop2 PE=2 SV=1 Back     alignment and function description
>sp|O94268|NOP2_SCHPO Putative ribosomal RNA methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.20c PE=1 SV=1 Back     alignment and function description
>sp|P40991|NOP2_YEAST Putative ribosomal RNA methyltransferase Nop2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP2 PE=1 SV=1 Back     alignment and function description
>sp|P45679|RSMB_COXBU Ribosomal RNA small subunit methyltransferase B OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A9MN78|RSMB_SALAR Ribosomal RNA small subunit methyltransferase B OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q6D000|RSMB_ERWCT Ribosomal RNA small subunit methyltransferase B OS=Erwinia carotovora subsp. atroseptica (strain SCRI 1043 / ATCC BAA-672) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|Q9V106|TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06230 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
357609454 666 hypothetical protein KGM_08224 [Danaus p 0.722 0.097 0.769 6e-24
195442109 866 GK17973 [Drosophila willistoni] gi|19416 0.722 0.075 0.707 5e-23
91090670 731 PREDICTED: similar to CG8545 CG8545-PA [ 0.7 0.086 0.777 1e-22
383851252 596 PREDICTED: putative ribosomal RNA methyl 0.722 0.109 0.738 3e-22
195333786 865 GM21395 [Drosophila sechellia] gi|194125 0.722 0.075 0.692 6e-22
194883628 897 GG20307 [Drosophila erecta] gi|190659090 0.722 0.072 0.692 6e-22
22024126 891 CG8545 [Drosophila melanogaster] gi|2162 0.722 0.072 0.692 7e-22
195485322 902 GE12467 [Drosophila yakuba] gi|194177145 0.722 0.072 0.692 7e-22
194752730 896 GF12515 [Drosophila ananassae] gi|190619 0.722 0.072 0.676 9e-22
345481794 786 PREDICTED: putative ribosomal RNA methyl 0.722 0.082 0.707 2e-21
>gi|357609454|gb|EHJ66457.1| hypothetical protein KGM_08224 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/65 (76%), Positives = 59/65 (90%)

Query: 26  VILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVN 85
           ++L AIDC NA+S TGGY+VYSTCSILPEENE VVNYAL++R+VKLVPTGLDFGTEGFV 
Sbjct: 514 LLLAAIDCCNAKSSTGGYIVYSTCSILPEENEWVVNYALKRRNVKLVPTGLDFGTEGFVK 573

Query: 86  YRQNK 90
           YR ++
Sbjct: 574 YRHHR 578

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195442109|ref|XP_002068802.1| GK17973 [Drosophila willistoni] gi|194164887|gb|EDW79788.1| GK17973 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|91090670|ref|XP_974410.1| PREDICTED: similar to CG8545 CG8545-PA [Tribolium castaneum] gi|270013309|gb|EFA09757.1| hypothetical protein TcasGA2_TC011896 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383851252|ref|XP_003701148.1| PREDICTED: putative ribosomal RNA methyltransferase nop2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195333786|ref|XP_002033567.1| GM21395 [Drosophila sechellia] gi|194125537|gb|EDW47580.1| GM21395 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194883628|ref|XP_001975903.1| GG20307 [Drosophila erecta] gi|190659090|gb|EDV56303.1| GG20307 [Drosophila erecta] Back     alignment and taxonomy information
>gi|22024126|ref|NP_610786.2| CG8545 [Drosophila melanogaster] gi|21627400|gb|AAF58504.2| CG8545 [Drosophila melanogaster] gi|254039763|gb|ACT56594.1| LD11307p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195485322|ref|XP_002091044.1| GE12467 [Drosophila yakuba] gi|194177145|gb|EDW90756.1| GE12467 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194752730|ref|XP_001958672.1| GF12515 [Drosophila ananassae] gi|190619970|gb|EDV35494.1| GF12515 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|345481794|ref|XP_001604770.2| PREDICTED: putative ribosomal RNA methyltransferase NOP2-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
FB|FBgn0033741 891 CG8545 [Drosophila melanogaste 0.722 0.072 0.692 1.1e-20
ZFIN|ZDB-GENE-050309-7 739 nop2 "NOP2 nucleolar protein h 0.722 0.087 0.676 3.1e-18
UNIPROTKB|F1N3G2 820 NOP2 "Uncharacterized protein" 0.722 0.079 0.661 4.8e-18
UNIPROTKB|E2RCH6 826 NOP2 "Uncharacterized protein" 0.722 0.078 0.661 4.8e-18
RGD|1304616 772 Nop2 "NOP2 nucleolar protein" 0.722 0.084 0.661 9.1e-18
UNIPROTKB|P46087 812 NOP2 "Putative ribosomal RNA m 0.722 0.080 0.661 9.8e-18
UNIPROTKB|F1SLR6 821 NOP2 "Uncharacterized protein" 0.722 0.079 0.646 3.4e-17
TAIR|locus:2178393 682 OLI2 "OLIGOCELLULA 2" [Arabido 0.722 0.095 0.615 5.3e-17
MGI|MGI:107891 793 Nop2 "NOP2 nucleolar protein" 0.722 0.081 0.646 5.3e-17
TAIR|locus:2133832 671 AT4G26600 [Arabidopsis thalian 0.722 0.096 0.615 6.6e-17
FB|FBgn0033741 CG8545 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 1.1e-20, P = 1.1e-20
 Identities = 45/65 (69%), Positives = 58/65 (89%)

Query:    26 VILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVN 85
             ++L AIDC +A+S TGGY+VYSTCS+LPEENE V++YAL+KR+VKLVPTGLDFG EGF  
Sbjct:   545 LLLTAIDCTDAKSSTGGYIVYSTCSVLPEENEWVIDYALKKRNVKLVPTGLDFGVEGFTK 604

Query:    86 YRQNK 90
             +RQ++
Sbjct:   605 FRQHR 609
GO:0005730 "nucleolus" evidence=ISS
GO:0006364 "rRNA processing" evidence=ISS
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
ZFIN|ZDB-GENE-050309-7 nop2 "NOP2 nucleolar protein homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3G2 NOP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCH6 NOP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1304616 Nop2 "NOP2 nucleolar protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46087 NOP2 "Putative ribosomal RNA methyltransferase NOP2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLR6 NOP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2178393 OLI2 "OLIGOCELLULA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:107891 Nop2 "NOP2 nucleolar protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2133832 AT4G26600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O94268NOP2_SCHPO2, ., 1, ., 1, ., -0.52560.85550.1266yesN/A
Q922K7NOP2_MOUSE2, ., 1, ., 1, ., -0.64610.72220.0819yesN/A
P40991NOP2_YEAST2, ., 1, ., 1, ., -0.56060.72220.1051yesN/A
P46087NOP2_HUMAN2, ., 1, ., 1, ., -0.66150.72220.0800yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 3e-14
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 1e-13
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 6e-12
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 1e-08
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 2e-08
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 1e-06
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 1e-05
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 2e-05
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 5e-05
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 0.002
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 65.9 bits (161), Expect = 3e-14
 Identities = 22/42 (52%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 41  GGYLVYSTCSILPEENEAVVNYALRKR-DVKLVPTGLDFGTE 81
           GG LVYSTCS+ PEENE VV   L +  D +L P  L +G  
Sbjct: 281 GGVLVYSTCSLTPEENEEVVERFLERHPDFELEPVRLPWGPL 322

Length = 355
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
KOG1122|consensus460 99.79
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 99.77
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.72
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 99.7
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.66
PRK14901434 16S rRNA methyltransferase B; Provisional 99.64
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.63
PRK14903431 16S rRNA methyltransferase B; Provisional 99.62
PRK14904445 16S rRNA methyltransferase B; Provisional 99.55
PRK10901427 16S rRNA methyltransferase B; Provisional 99.52
KOG2198|consensus375 99.48
PRK14902444 16S rRNA methyltransferase B; Provisional 99.47
KOG2360|consensus413 98.81
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 95.66
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 95.35
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.26
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 94.26
PRK14968188 putative methyltransferase; Provisional 93.88
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 93.33
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 92.81
PRK14967223 putative methyltransferase; Provisional 92.0
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 91.98
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 91.67
KOG1540|consensus296 90.87
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 90.82
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 90.69
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 90.56
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 89.63
PRK07402196 precorrin-6B methylase; Provisional 89.42
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 87.76
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 87.63
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 87.6
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 87.54
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 87.49
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 87.36
COG4123248 Predicted O-methyltransferase [General function pr 87.03
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 86.88
CHL00073 457 chlN photochlorophyllide reductase subunit N 86.56
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 86.44
COG1092393 Predicted SAM-dependent methyltransferases [Genera 86.07
TIGR00438188 rrmJ cell division protein FtsJ. 85.97
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 85.54
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 85.38
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 85.3
PRK04266226 fibrillarin; Provisional 85.08
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 84.44
KOG1099|consensus294 84.12
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 83.94
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 83.49
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 83.25
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 83.23
TIGR00452314 methyltransferase, putative. Known examples to dat 83.08
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 83.08
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 82.9
TIGR01282 466 nifD nitrogenase molybdenum-iron protein alpha cha 82.6
cd01972 426 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE 82.54
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 82.44
PF13728215 TraF: F plasmid transfer operon protein 82.23
TIGR00536284 hemK_fam HemK family putative methylases. The gene 82.01
cd01967 406 Nitrogenase_MoFe_alpha_like Nitrogenase_MoFe_alpha 81.63
cd01979 396 Pchlide_reductase_N Pchlide_reductase_N: N protein 81.48
PRK13703248 conjugal pilus assembly protein TraF; Provisional 81.1
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 80.15
>KOG1122|consensus Back     alignment and domain information 
Probab=99.79  E-value=2.9e-19  Score=141.82  Aligned_cols=68  Identities=56%  Similarity=0.835  Sum_probs=63.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCEEEEEcCCCCcccCHHHHHHHHhcC-CcEEeecCCCCCCCC
Q psy7378          11 LALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKR-DVKLVPTGLDFGTEG   82 (90)
Q Consensus        11 ~~~~~l~~l~~~Q~~Ll~~al~~~~~~lkpgG~lvYsTCS~~~eENE~vV~~~l~~~-~~~l~~~~~~~g~dG   82 (90)
                      +...++.+++.+|++||.+|++    +|++||+|||||||+.++|||.||+++|+++ +++++|.++.+|.+|
T Consensus       338 k~~~di~~~~~LQr~LllsAi~----lv~~GGvLVYSTCSI~~~ENE~vV~yaL~K~p~~kL~p~~~~iG~~G  406 (460)
T KOG1122|consen  338 KTVKDILRYAHLQRELLLSAID----LVKAGGVLVYSTCSITVEENEAVVDYALKKRPEVKLVPTGLDIGGEG  406 (460)
T ss_pred             hhHHHHHHhHHHHHHHHHHHHh----hccCCcEEEEEeeecchhhhHHHHHHHHHhCCceEeccccccCCCCC
Confidence            4578899999999999988775    4699999999999999999999999999999 899999999999999

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>CHL00073 chlN photochlorophyllide reductase subunit N Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01282 nifD nitrogenase molybdenum-iron protein alpha chain Back     alignment and domain information
>cd01972 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE subunit of the VnfEN complex_like Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>cd01967 Nitrogenase_MoFe_alpha_like Nitrogenase_MoFe_alpha_like: Nitrogenase MoFe protein, alpha subunit_like Back     alignment and domain information
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 1e-06
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 9e-05
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 3e-04
3m6u_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 8e-04
3m6w_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 9e-04
3m6x_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 9e-04
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 2/45 (4%)
Query: 41  GGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVN 85
           GG LVYSTCS+ PEENE V+ +AL   DV+L+P  L +G     N
Sbjct: 239 GGILVYSTCSLEPEENEFVIQWALDNFDVELLP--LKYGEPALTN 281
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 Back     alignment and structure
>pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 Back     alignment and structure
>pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 1e-21
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 7e-21
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 4e-20
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 7e-20
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 6e-19
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 2e-18
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 1e-12
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 3e-12
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
 Score = 84.9 bits (211), Expect = 1e-21
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 27  ILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKRDVKLVPTGLDFGTEGFVNY 86
           + + ++ L      GG LVYSTCS+ PEENE V+ +AL   DV+L+P  L +G     N 
Sbjct: 229 LEKGLEVLK----PGGILVYSTCSLEPEENEFVIQWALDNFDVELLP--LKYGEPALTNP 282

Query: 87  RQNK 90
              +
Sbjct: 283 FGIE 286
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 99.69
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.56
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.52
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.52
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.44
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.43
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.43
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.36
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.35
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.49
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.79
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.24
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 95.86
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 95.57
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 95.56
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 95.33
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.28
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 94.7
2qm3_A373 Predicted methyltransferase; putative methyltransf 94.64
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 94.44
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 94.4
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 94.24
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 94.21
3duw_A223 OMT, O-methyltransferase, putative; alternating of 93.88
2frn_A278 Hypothetical protein PH0793; structural genomics, 93.86
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 93.44
2b3t_A276 Protein methyltransferase HEMK; translation termin 93.37
2b78_A385 Hypothetical protein SMU.776; structure genomics, 93.31
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 93.26
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 93.05
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 92.66
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 92.6
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 92.56
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 92.44
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 92.06
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 91.92
3dh0_A219 SAM dependent methyltransferase; cystal structure, 91.81
3lpm_A259 Putative methyltransferase; structural genomics, p 91.79
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 91.71
3lcc_A235 Putative methyl chloride transferase; halide methy 91.7
1yb2_A275 Hypothetical protein TA0852; structural genomics, 91.58
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 91.5
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 91.48
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 91.47
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 91.45
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 91.43
3hnr_A220 Probable methyltransferase BT9727_4108; structural 91.37
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 91.36
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 91.36
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 91.01
3f4k_A257 Putative methyltransferase; structural genomics, P 90.91
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 90.89
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 90.36
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 90.26
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 90.15
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 90.14
2i62_A265 Nicotinamide N-methyltransferase; structural genom 90.13
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 90.1
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 90.06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 89.9
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 89.88
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 89.83
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 89.55
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 89.48
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 89.26
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 89.0
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 88.79
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 88.75
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 88.72
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 88.62
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 88.5
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 88.28
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 88.26
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 88.24
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 87.67
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 87.41
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 87.27
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 87.19
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 86.76
3i9f_A170 Putative type 11 methyltransferase; structural gen 86.67
2p7i_A250 Hypothetical protein; putative methyltransferase, 86.61
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 86.47
3dtn_A234 Putative methyltransferase MM_2633; structural gen 86.34
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 86.27
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 86.13
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 85.97
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 85.48
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 85.45
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 85.26
1vlm_A219 SAM-dependent methyltransferase; possible histamin 85.25
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 84.32
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 84.03
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 84.01
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 84.01
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 83.62
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 83.56
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 83.25
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 83.21
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 83.19
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 83.07
3dp7_A363 SAM-dependent methyltransferase; structural genomi 82.69
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 82.61
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 82.55
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 82.47
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 82.46
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 82.18
1xxl_A239 YCGJ protein; structural genomics, protein structu 82.15
2kw5_A202 SLR1183 protein; structural genomics, northeast st 82.12
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 82.09
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 82.0
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 81.98
2hlg_A39 Fruit-specific protein; beta antiparallel, plant p 81.95
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 81.71
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 81.49
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 81.38
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 81.21
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 81.15
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 80.92
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 80.89
3ocj_A305 Putative exported protein; structural genomics, PS 80.77
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 80.55
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
Probab=99.69  E-value=1.4e-17  Score=127.97  Aligned_cols=53  Identities=25%  Similarity=0.318  Sum_probs=46.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCEEEEEcCCCCcccCHHHHHHHHhcC
Q psy7378          11 LALRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKR   67 (90)
Q Consensus        11 ~~~~~l~~l~~~Q~~Ll~~al~~~~~~lkpgG~lvYsTCS~~~eENE~vV~~~l~~~   67 (90)
                      .+.+++..|+.+|++||.+|+    ++|||||+|||||||++|+|||+||++||+++
T Consensus       251 ~~~~~~~~l~~lQ~~iL~~a~----~~lkpGG~LVYsTCSl~~~ENE~vV~~~L~~~  303 (359)
T 4fzv_A          251 SRKKERQILPVLQVQLLAAGL----LATKPGGHVVYSTCSLSHLQNEYVVQGAIELL  303 (359)
T ss_dssp             GGHHHHHTHHHHHHHHHHHHH----HTEEEEEEEEEEESCCCTTTTHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHH----hcCCCCcEEEEEeCCCchhhCHHHHHHHHHhC
Confidence            455788999999999887765    56799999999999999999999999999865
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2hlg_A Fruit-specific protein; beta antiparallel, plant protein; NMR {Lycopersicon esculentum} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 1e-11
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 3e-10
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 6e-09
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 2e-05
d1c7na_394 c.67.1.3 (A:) Cystalysin {Treponema denticola [Tax 4e-04
d1xi9a_395 c.67.1.1 (A:) Putative alanine aminotransferase {P 6e-04
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 56.3 bits (134), Expect = 1e-11
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query: 39  PTGGYLVYSTCSILPEENEAVVNYALRKR-DVKLVPTGLDF-----------GTEGF 83
            TGG LVY+TCS+LPEEN   +   L++  D +L  TG                +GF
Sbjct: 221 KTGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPGAEEGDGF 277
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Length = 394 Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 99.81
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.78
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 97.63
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 97.44
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.79
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 94.44
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 92.28
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.43
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 88.92
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 88.76
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 88.38
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 88.27
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 87.71
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 85.57
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 84.96
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 83.37
d1r7ma2105 DNA endonuclease I-SceI {Baker's yeast (Saccharomy 83.16
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 82.81
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 82.67
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 82.1
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 81.88
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 81.56
d1m1na_ 477 Nitrogenase iron-molybdenum protein, alpha chain { 80.84
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 80.48
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 80.11
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.81  E-value=7.2e-21  Score=139.57  Aligned_cols=70  Identities=31%  Similarity=0.468  Sum_probs=59.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcCCCCCEEEEEcCCCCcccCHHHHHHHHhcC-CcEEeecC----------C-CCCC
Q psy7378          13 LRALSTIGKTSLIVILEAIDCLNARSPTGGYLVYSTCSILPEENEAVVNYALRKR-DVKLVPTG----------L-DFGT   80 (90)
Q Consensus        13 ~~~l~~l~~~Q~~Ll~~al~~~~~~lkpgG~lvYsTCS~~~eENE~vV~~~l~~~-~~~l~~~~----------~-~~g~   80 (90)
                      .+++.+++.+|++||.+|    +++|||||+|||||||++|+|||+||++||+++ ++++++..          | ..++
T Consensus       199 ~~~~~~l~~lQ~~iL~~a----~~~lk~gG~lvYsTCS~~~~ENE~vv~~~l~~~~~~~~~~~~~~~~~~~~~~P~~~~~  274 (284)
T d1sqga2         199 DRDIPELAQLQSEILDAI----WPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPGAEEG  274 (284)
T ss_dssp             TTHHHHHHHHHHHHHHHH----GGGEEEEEEEEEEESCCCGGGTHHHHHHHHHHCTTCEECSSBCSSSBSEEECCCTTSC
T ss_pred             cchhhHHHHHHHHHHHHH----HHhcCCCceEEEeeecCchhhCHHHHHHHHHhCCCcEEecCCCCCCCcEEECCCCCCc
Confidence            367889999999988765    466799999999999999999999999999998 89987752          1 2468


Q ss_pred             CCcccc
Q psy7378          81 EGFVNY   86 (90)
Q Consensus        81 dGf~~~   86 (90)
                      ||||..
T Consensus       275 dGFF~A  280 (284)
T d1sqga2         275 DGFFYA  280 (284)
T ss_dssp             CSEEEE
T ss_pred             ccEEEE
Confidence            999864
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure