Diaphorina citri psyllid: psy7387


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MEVEEAASSNDVHIEEPKDVENDLSLKDHLLGQLDQVEAHVEELRKMASQLENEKDQILTTIHTLKNMDSLNDIGDNDKDDILRYLDRISLRCTTIDVCVHTLRSDDQVESLHQVNCLIDNLIIGMRETPEQTQTKCLSYVAACSSSSTVGNGDKTFEHAVLGCALDDQKRIRQRLNGLLDYMTKEKWKKAIQPMD
cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHcccEEEEEEECcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
*****************************LLGQLDQVEAHVEELRKMASQLENEKDQILTTIHTLKNMDSLNDIGDNDKDDILRYLDRISLRCTTIDVCVHTLRSDDQVESLHQVNCLIDNLIIGMRETPEQTQTKCLSYVAACSSSSTVGNGDKTFEHAVLGCALDDQKRIRQRLNGLLDYMTKEKWK*A*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVEEAASSNDVHIEEPKDVENDLSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDSLNDIGDNDKDDILRYLDRISLRCTTIDVCVHTLRSDDQVESLHQVNCLIDNLIIGMRETPEQTQTKCLSYVAACSSSSTVGNGDKTFEHAVLGCALDDQKRIRQRLNGLLDYMTKEKWKKAIQPMD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BAG family molecular chaperone regulator 2 Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.confidentO95816
BAG family molecular chaperone regulator 2 Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.confidentQ91YN9
BAG family molecular chaperone regulator 2 Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.confidentQ3ZBG5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CQX, chain C
Confidence level:very confident
Coverage over the Query: 110-192
View the alignment between query and template
View the model in PyMOL
Template: 3M48, chain A
Confidence level:probable
Coverage over the Query: 35-62
View the alignment between query and template
View the model in PyMOL