Diaphorina citri psyllid: psy7393

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55

MGSSNDEPIEDEEEEGARINFVALKRAVLRSRVEMMKGSFFLGAFSTDAAGQLDVLGHDGHSLGVDGAQVRVLEQTHQVGLASLLQGHHGRALEAQVGLEVLGDLTHQTLERQLADQQLGALLVATDLTESHRAGTVTVGLLHAAGGRRALAGCLRRQLLPRGLASGRLASGLLRTGHVCKRNDSSITQSRSFSIPGAVPIPQIYTMSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGLKAEFSITISLFSFVFDNEAVPIQQNYTMSGRGKGGKTKTKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTHSWWCLTAETVQGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGTSFSESLSSLTTAGHDELVLLLLLLRNEEQV

cccccccccccHHHHccccHHHHHHHHHHHccEEEEcccccccccccccccccCECccccccccccccEEEEEEccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHcccEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccHHHcccccccccHHHHHHHHHHccccccc

******************INFVALKRAVLRSRVEMMKGSFFLGAFSTDAAGQLDVLGHDGHSLGVDGAQVRVLEQTHQVGLASLLQGHHGRALEAQVGLEVLGDLTHQTLERQLADQQLGALLVATDLTESHRAGTVTVGLLHAAGGRRALAGCLRRQLLPRGLASGRLASGLLRTGHVCK***********************************************LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGLKAEFSITISLFSFVFDNEAVPI**************************GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTHSWWCLTAETVQGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLE**T************************GDSLDVVTEYFPVPLGTSFSESLSSLTTAGHDELVLLLLLLRN****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone H2A type 1-H	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q96KK5
Histone H2A type 2-B	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q8IUE6
Histone H2A type 1-A	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q96QV6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000003 [BP]	reproduction	confident	GO:0008150
GO:0005657 [CC]	replication fork	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0060465 [BP]	pharynx development	confident	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040011 [BP]	locomotion	confident	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	confident	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0000790 [CC]	nuclear chromatin	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0019899 [MF]	enzyme binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0005811 [CC]	lipid particle	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000781 [CC]	chromosome, telomeric region	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003677 [MF]	DNA binding	confident	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006915 [BP]	apoptotic process	confident	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0000077 [BP]	DNA damage checkpoint	confident	GO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0042742 [BP]	defense response to bacterium	confident	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0009792 [BP]	embryo development ending in birth or egg hatching	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]	growth	confident	GO:0008150
GO:0051298 [BP]	centrosome duplication	probable	GO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0006334 [BP]	nucleosome assembly	probable	GO:0034728, GO:0071103, GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0031497, GO:0034622, GO:0044699, GO:0071824, GO:0006139, GO:0044260, GO:0006325, GO:1901360, GO:0006323, GO:0065003, GO:0071704, GO:0071840, GO:0065004, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0006333, GO:0044237, GO:0043170, GO:0044085, GO:0006259, GO:0008150
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0031618 [CC]	nuclear centromeric heterochromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0000775, GO:0005720, GO:0005721, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0031298 [CC]	replication fork protection complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042393 [MF]	histone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0001673 [CC]	male germ cell nucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0001741 [CC]	XY body	probable	GO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006997 [BP]	nucleus organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0003684 [MF]	damaged DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005834 [CC]	heterotrimeric G-protein complex	probable	GO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0044030 [BP]	regulation of DNA methylation	probable	GO:0051052, GO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789, GO:0080090
GO:0071168 [BP]	protein localization to chromatin	probable	GO:0008104, GO:0034502, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0006975 [BP]	DNA damage induced protein phosphorylation	probable	GO:0016310, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0006468, GO:0009987, GO:0006464, GO:0006974, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0044238, GO:0019538, GO:0050896, GO:0006950, GO:0044237, GO:0043170, GO:0006796, GO:0033554, GO:0006793, GO:0008150
GO:0009294 [BP]	DNA mediated transformation	probable	GO:0009987, GO:0009292, GO:0044764, GO:0008150, GO:0051704
GO:0007186 [BP]	G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0010212 [BP]	response to ionizing radiation	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000788 [CC]	nuclear nucleosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000786, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0031011 [CC]	Ino80 complex	probable	GO:0033202, GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000812 [CC]	Swr1 complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0034501 [BP]	protein localization to kinetochore	probable	GO:0008104, GO:0034502, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0001740 [CC]	Barr body	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0000805, GO:0000803, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0009611 [BP]	response to wounding	probable	GO:0006950, GO:0008150, GO:0050896
GO:0005700 [CC]	polytene chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0045739 [BP]	positive regulation of DNA repair	probable	GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522
GO:0004871 [MF]	signal transducer activity	probable	GO:0060089, GO:0003674
GO:0042770 [BP]	signal transduction in response to DNA damage	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F8N, chain K
Confidence level:very confident
Coverage over the Query: 229-324
View the alignment between query and template
View the model in PyMOL

Template: 2F8N, chain K
Confidence level:very confident
Coverage over the Query: 371-476
View the alignment between query and template
View the model in PyMOL