Psyllid ID: psy7393
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 549 | ||||||
| 157137737 | 124 | histone h2a [Aedes aegypti] gi|108880814 | 0.209 | 0.927 | 0.956 | 7e-55 | |
| 405975240 | 133 | Histone H2A [Crassostrea gigas] | 0.209 | 0.864 | 0.947 | 9e-55 | |
| 162319741 | 123 | histone H2A [Penaeus monodon] | 0.209 | 0.934 | 0.956 | 1e-54 | |
| 395736870 | 612 | PREDICTED: uncharacterized protein LOC10 | 0.227 | 0.204 | 0.849 | 5e-54 | |
| 122044770 | 125 | RecName: Full=Histone H2A | 0.209 | 0.92 | 0.930 | 5e-54 | |
| 358255301 | 215 | histone H2A [Clonorchis sinensis] | 0.214 | 0.548 | 0.900 | 6e-54 | |
| 195371155 | 124 | GM13182 [Drosophila sechellia] gi|194122 | 0.209 | 0.927 | 0.939 | 7e-54 | |
| 256087701 | 125 | histone H2A [Schistosoma mansoni] gi|353 | 0.209 | 0.92 | 0.930 | 1e-53 | |
| 195562366 | 124 | GD12842 [Drosophila simulans] gi|1942026 | 0.209 | 0.927 | 0.939 | 1e-53 | |
| 196012824 | 137 | conserved hypothetical protein [Trichopl | 0.209 | 0.839 | 0.904 | 2e-53 |
| >gi|157137737|ref|XP_001657157.1| histone h2a [Aedes aegypti] gi|108880814|gb|EAT45039.1| AAEL003669-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 221 bits (563), Expect = 7e-55, Method: Compositional matrix adjust.
Identities = 110/115 (95%), Positives = 112/115 (97%)
Query: 207 MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA 266
MSGRGKGGK +AK+KTRSSRAGLQFPVGR HRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct: 1 MSGRGKGGKVRAKAKTRSSRAGLQFPVGRTHRLLRKGNYAERVGAGAPVYLAAVMEYLAA 60
Query: 267 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGL 321
EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA L
Sbjct: 61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVL 115
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|405975240|gb|EKC39821.1| Histone H2A [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|162319741|gb|ABX84387.1| histone H2A [Penaeus monodon] | Back alignment and taxonomy information |
|---|
| >gi|395736870|ref|XP_002816564.2| PREDICTED: uncharacterized protein LOC100439702 [Pongo abelii] | Back alignment and taxonomy information |
|---|
| >gi|122044770|sp|P02269.2|H2A_ASTRU RecName: Full=Histone H2A | Back alignment and taxonomy information |
|---|
| >gi|358255301|dbj|GAA57014.1| histone H2A [Clonorchis sinensis] | Back alignment and taxonomy information |
|---|
| >gi|195371155|ref|XP_002045914.1| GM13182 [Drosophila sechellia] gi|194122083|gb|EDW44126.1| GM13182 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|256087701|ref|XP_002580003.1| histone H2A [Schistosoma mansoni] gi|353231318|emb|CCD77736.1| putative histone H2A [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|195562366|ref|XP_002077504.1| GD12842 [Drosophila simulans] gi|194202619|gb|EDX16195.1| GD12842 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|196012824|ref|XP_002116274.1| conserved hypothetical protein [Trichoplax adhaerens] gi|190581229|gb|EDV21307.1| conserved hypothetical protein [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 549 | ||||||
| FB|FBgn0051618 | 124 | His2A:CG31618 "His2A:CG31618" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053808 | 124 | His2A:CG33808 "His2A:CG33808" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053814 | 124 | His2A:CG33814 "His2A:CG33814" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053817 | 124 | His2A:CG33817 "His2A:CG33817" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053820 | 124 | His2A:CG33820 "His2A:CG33820" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053823 | 124 | His2A:CG33823 "His2A:CG33823" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053826 | 124 | His2A:CG33826 "His2A:CG33826" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053829 | 124 | His2A:CG33829 "His2A:CG33829" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053832 | 124 | His2A:CG33832 "His2A:CG33832" | 0.169 | 0.75 | 0.989 | 7.3e-43 | |
| FB|FBgn0053835 | 124 | His2A:CG33835 "His2A:CG33835" | 0.169 | 0.75 | 0.989 | 7.3e-43 |
| FB|FBgn0051618 His2A:CG31618 "His2A:CG31618" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 453 (164.5 bits), Expect = 7.3e-43, P = 7.3e-43
Identities = 92/93 (98%), Positives = 92/93 (98%)
Query: 229 LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 288
LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH
Sbjct: 23 LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82
Query: 289 LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGL 321
LQLAIRNDEELNKLLSGVTIAQGGVLPNIQA L
Sbjct: 83 LQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVL 115
|
|
| FB|FBgn0053808 His2A:CG33808 "His2A:CG33808" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053814 His2A:CG33814 "His2A:CG33814" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053817 His2A:CG33817 "His2A:CG33817" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053820 His2A:CG33820 "His2A:CG33820" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053823 His2A:CG33823 "His2A:CG33823" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053826 His2A:CG33826 "His2A:CG33826" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053829 His2A:CG33829 "His2A:CG33829" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053832 His2A:CG33832 "His2A:CG33832" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053835 His2A:CG33835 "His2A:CG33835" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 549 | |||
| PTZ00017 | 134 | PTZ00017, PTZ00017, histone H2A; Provisional | 5e-66 | |
| cd00074 | 115 | cd00074, H2A, Histone 2A; H2A is a subunit of the | 2e-64 | |
| PLN00157 | 132 | PLN00157, PLN00157, histone H2A; Provisional | 8e-62 | |
| smart00414 | 106 | smart00414, H2A, Histone 2A | 1e-58 | |
| PLN00156 | 139 | PLN00156, PLN00156, histone H2AX; Provisional | 6e-53 | |
| COG5262 | 132 | COG5262, HTA1, Histone H2A [Chromatin structure an | 3e-52 | |
| PLN00153 | 129 | PLN00153, PLN00153, histone H2A; Provisional | 3e-49 | |
| PLN00154 | 136 | PLN00154, PLN00154, histone H2A; Provisional | 3e-38 | |
| PTZ00017 | 134 | PTZ00017, PTZ00017, histone H2A; Provisional | 4e-38 | |
| cd00074 | 115 | cd00074, H2A, Histone 2A; H2A is a subunit of the | 3e-37 | |
| PLN00157 | 132 | PLN00157, PLN00157, histone H2A; Provisional | 2e-36 | |
| smart00414 | 106 | smart00414, H2A, Histone 2A | 7e-33 | |
| PLN00156 | 139 | PLN00156, PLN00156, histone H2AX; Provisional | 9e-31 | |
| PLN00153 | 129 | PLN00153, PLN00153, histone H2A; Provisional | 8e-29 | |
| PTZ00252 | 134 | PTZ00252, PTZ00252, histone H2A; Provisional | 3e-28 | |
| COG5262 | 132 | COG5262, HTA1, Histone H2A [Chromatin structure an | 5e-28 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 1e-23 | |
| PLN00154 | 136 | PLN00154, PLN00154, histone H2A; Provisional | 3e-21 | |
| PLN00155 | 58 | PLN00155, PLN00155, histone H2A; Provisional | 1e-19 | |
| PLN00155 | 58 | PLN00155, PLN00155, histone H2A; Provisional | 2e-19 | |
| PTZ00252 | 134 | PTZ00252, PTZ00252, histone H2A; Provisional | 1e-16 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 2e-16 | |
| COG5247 | 113 | COG5247, BUR6, Class 2 transcription repressor NC2 | 1e-05 | |
| pfam00808 | 65 | pfam00808, CBFD_NFYB_HMF, Histone-like transcripti | 0.001 |
| >gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional | Back alignment and domain information |
|---|
Score = 210 bits (536), Expect = 5e-66
Identities = 88/118 (74%), Positives = 99/118 (83%), Gaps = 3/118 (2%)
Query: 207 MSGRGKGGKAKAKSK---TRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEY 263
G+GK G KA K +RS++AGLQFPVGR+HR L+KG YA+RVGAGAPVYLAAV+EY
Sbjct: 1 KGGKGKTGGGKAGKKKPVSRSAKAGLQFPVGRVHRYLKKGRYAKRVGAGAPVYLAAVLEY 60
Query: 264 LAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGL 321
L AEVLELAGNAA+DNKK RI PRH+QLAIRNDEELNKLL+GVTIA GGVLPNI L
Sbjct: 61 LTAEVLELAGNAAKDNKKKRITPRHIQLAIRNDEELNKLLAGVTIASGGVLPNIHKVL 118
|
Length = 134 |
| >gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197711 smart00414, H2A, Histone 2A | Back alignment and domain information |
|---|
| >gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197711 smart00414, H2A, Histone 2A | Back alignment and domain information |
|---|
| >gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 549 | |||
| PLN00153 | 129 | histone H2A; Provisional | 100.0 | |
| PLN00157 | 132 | histone H2A; Provisional | 100.0 | |
| PTZ00017 | 134 | histone H2A; Provisional | 100.0 | |
| PLN00156 | 139 | histone H2AX; Provisional | 100.0 | |
| PLN00153 | 129 | histone H2A; Provisional | 100.0 | |
| PTZ00252 | 134 | histone H2A; Provisional | 100.0 | |
| PLN00157 | 132 | histone H2A; Provisional | 100.0 | |
| KOG1756|consensus | 131 | 100.0 | ||
| PLN00154 | 136 | histone H2A; Provisional | 100.0 | |
| smart00414 | 106 | H2A Histone 2A. | 100.0 | |
| PLN00156 | 139 | histone H2AX; Provisional | 100.0 | |
| PTZ00017 | 134 | histone H2A; Provisional | 100.0 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 100.0 | |
| KOG1756|consensus | 131 | 100.0 | ||
| PTZ00252 | 134 | histone H2A; Provisional | 100.0 | |
| PLN00154 | 136 | histone H2A; Provisional | 100.0 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 100.0 | |
| smart00414 | 106 | H2A Histone 2A. | 100.0 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 100.0 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 100.0 | |
| KOG1757|consensus | 131 | 99.97 | ||
| KOG1757|consensus | 131 | 99.97 | ||
| PLN00155 | 58 | histone H2A; Provisional | 99.83 | |
| PLN00155 | 58 | histone H2A; Provisional | 99.8 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.18 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.15 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 98.95 | |
| KOG1659|consensus | 224 | 98.5 | ||
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 98.44 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 98.23 | |
| PLN00035 | 103 | histone H4; Provisional | 98.04 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 97.92 | |
| KOG1659|consensus | 224 | 97.89 | ||
| PLN00035 | 103 | histone H4; Provisional | 97.84 | |
| PTZ00015 | 102 | histone H4; Provisional | 97.36 | |
| PTZ00015 | 102 | histone H4; Provisional | 97.26 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 97.01 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 96.76 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 96.5 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 96.4 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 96.29 | |
| KOG1657|consensus | 236 | 95.92 | ||
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 95.85 | |
| smart00417 | 74 | H4 Histone H4. | 95.41 | |
| smart00417 | 74 | H4 Histone H4. | 95.33 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 95.17 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 94.76 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 94.59 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 94.53 | |
| KOG1657|consensus | 236 | 93.72 | ||
| smart00427 | 89 | H2B Histone H2B. | 92.82 | |
| PLN00158 | 116 | histone H2B; Provisional | 92.11 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 90.95 | |
| PTZ00463 | 117 | histone H2B; Provisional | 90.67 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 90.66 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 90.57 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 90.35 | |
| PLN00158 | 116 | histone H2B; Provisional | 90.27 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 90.19 | |
| PTZ00463 | 117 | histone H2B; Provisional | 89.8 | |
| KOG3219|consensus | 195 | 89.38 | ||
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 89.34 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 88.78 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 88.18 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 88.16 | |
| KOG3219|consensus | 195 | 86.76 | ||
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 86.47 | |
| smart00427 | 89 | H2B Histone H2B. | 85.17 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 82.6 | |
| smart00428 | 105 | H3 Histone H3. | 80.99 | |
| smart00428 | 105 | H3 Histone H3. | 80.01 |
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-44 Score=324.65 Aligned_cols=122 Identities=72% Similarity=1.074 Sum_probs=116.8
Q ss_pred ccCCCCCCCCCCccCCccccccccccchhhhhhhhcCCcccccCCChhHHHHHHHHHHHHHHHHHHHHHhhhcCCcccch
Q psy7393 207 MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP 286 (549)
Q Consensus 207 MSgrgk~gk~~~k~~SrSsRAGLqFPVsRI~RlLke~~ya~RIsssApVYLAAVLEYLtaEILELAGn~Ar~~kkkRITP 286 (549)
|||+|++++.+++..|||+||||||||+||+|||++++|+.||+++|||||+||||||++||||||+|+|++++++||+|
T Consensus 1 m~g~~~~~~~~~k~~srS~ragL~FpVgRi~R~Lr~g~~a~Rvga~A~VYLAAVLEYLtaEVLELAgnaa~d~kk~RItP 80 (129)
T PLN00153 1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 (129)
T ss_pred CCCCCCCCccccCccCcccccCcccchHHHHHHHhcCchhhccCCCchHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCh
Confidence 89998866656678999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhhhcCcHHHHhhhcCceeccccccCCcccccccccccc
Q psy7393 287 RHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGLKAEFSIT 328 (549)
Q Consensus 287 rHI~lAI~NDeEL~~Lfk~vtIs~GGVlP~I~~~ll~kK~~~ 328 (549)
+||++||+||+||++||+++||++|||+|+||++|++||+..
T Consensus 81 rHi~lAI~nDeEL~~Ll~~vTIa~GGV~P~i~~~l~~kk~~~ 122 (129)
T PLN00153 81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKG 122 (129)
T ss_pred HHHHhhccCcHHHHHHHCCCccCCCccCCCcchhhcCcccCC
Confidence 999999999999999999999999999999999999998643
|
|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >KOG1756|consensus | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG1756|consensus | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG1757|consensus | Back alignment and domain information |
|---|
| >KOG1757|consensus | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >KOG1659|consensus | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG1659|consensus | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >KOG1657|consensus | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1657|consensus | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG3219|consensus | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >KOG3219|consensus | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 549 | ||||
| 2nqb_C | 123 | Drosophila Nucleosome Structure Length = 123 | 4e-47 | ||
| 2nqb_C | 123 | Drosophila Nucleosome Structure Length = 123 | 5e-26 | ||
| 2pyo_C | 120 | Drosophila Nucleosome Core Length = 120 | 5e-47 | ||
| 2pyo_C | 120 | Drosophila Nucleosome Core Length = 120 | 5e-26 | ||
| 1eqz_A | 129 | X-Ray Structure Of The Nucleosome Core Particle At | 1e-44 | ||
| 1eqz_A | 129 | X-Ray Structure Of The Nucleosome Core Particle At | 9e-25 | ||
| 2hio_A | 128 | Histone Octamer (Chicken), Chromosomal Protein Leng | 1e-44 | ||
| 2hio_A | 128 | Histone Octamer (Chicken), Chromosomal Protein Leng | 9e-25 | ||
| 3c1b_C | 129 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 3e-44 | ||
| 3c1b_C | 129 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 4e-25 | ||
| 1zbb_C | 129 | Structure Of The 4_601_167 Tetranucleosome Length = | 3e-44 | ||
| 1zbb_C | 129 | Structure Of The 4_601_167 Tetranucleosome Length = | 4e-25 | ||
| 1m18_C | 129 | Ligand Binding Alters The Structure And Dynamics Of | 3e-44 | ||
| 1m18_C | 129 | Ligand Binding Alters The Structure And Dynamics Of | 5e-25 | ||
| 3a6n_C | 133 | The Nucleosome Containing A Testis-Specific Histone | 4e-44 | ||
| 3a6n_C | 133 | The Nucleosome Containing A Testis-Specific Histone | 2e-24 | ||
| 2cv5_C | 130 | Crystal Structure Of Human Nucleosome Core Particle | 4e-44 | ||
| 2cv5_C | 130 | Crystal Structure Of Human Nucleosome Core Particle | 2e-24 | ||
| 2f8n_K | 149 | 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc | 5e-44 | ||
| 2f8n_K | 149 | 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc | 2e-24 | ||
| 1aoi_C | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 1e-43 | ||
| 1aoi_C | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 1e-24 | ||
| 1s32_C | 119 | Molecular Recognition Of The Nucleosomal 'supergroo | 1e-43 | ||
| 1s32_C | 119 | Molecular Recognition Of The Nucleosomal 'supergroo | 1e-24 | ||
| 3kwq_C | 107 | Structural Characterization Of H3k56q Nucleosomes A | 1e-43 | ||
| 3kwq_C | 107 | Structural Characterization Of H3k56q Nucleosomes A | 1e-24 | ||
| 1kx3_C | 128 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 1e-43 | ||
| 1kx3_C | 128 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 1e-24 | ||
| 1zla_C | 129 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 7e-43 | ||
| 1zla_C | 129 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 1e-23 | ||
| 1hio_A | 95 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 8e-42 | ||
| 1hio_A | 95 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 1e-24 | ||
| 1id3_C | 131 | Crystal Structure Of The Yeast Nucleosome Core Part | 2e-41 | ||
| 1id3_C | 131 | Crystal Structure Of The Yeast Nucleosome Core Part | 7e-23 | ||
| 2xql_A | 91 | Fitting Of The H2a-H2b Histones In The Electron Mic | 2e-39 | ||
| 2xql_A | 91 | Fitting Of The H2a-H2b Histones In The Electron Mic | 1e-24 | ||
| 1u35_C | 120 | Crystal Structure Of The Nucleosome Core Particle C | 1e-29 | ||
| 1u35_C | 120 | Crystal Structure Of The Nucleosome Core Particle C | 2e-14 | ||
| 1f66_C | 128 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 3e-25 | ||
| 1f66_C | 128 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 1e-12 | ||
| 2jss_A | 192 | Nmr Structure Of Chaperone Chz1 Complexed With Hist | 2e-24 | ||
| 2jss_A | 192 | Nmr Structure Of Chaperone Chz1 Complexed With Hist | 3e-12 | ||
| 1q9c_A | 191 | Crystal Structure Of The Histone Domain Of Son Of S | 9e-05 | ||
| 1q9c_A | 191 | Crystal Structure Of The Histone Domain Of Son Of S | 4e-04 | ||
| 3ksy_A | 1049 | Crystal Structure Of The Histone Domain, Dh-Ph Unit | 2e-04 |
| >pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 | Back alignment and structure |
|
| >pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 | Back alignment and structure |
| >pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 | Back alignment and structure |
| >pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 | Back alignment and structure |
| >pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 | Back alignment and structure |
| >pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 | Back alignment and structure |
| >pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 | Back alignment and structure |
| >pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 | Back alignment and structure |
| >pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 | Back alignment and structure |
| >pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 | Back alignment and structure |
| >pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 | Back alignment and structure |
| >pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 | Back alignment and structure |
| >pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 | Back alignment and structure |
| >pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 | Back alignment and structure |
| >pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 | Back alignment and structure |
| >pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 | Back alignment and structure |
| >pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 | Back alignment and structure |
| >pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 | Back alignment and structure |
| >pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 | Back alignment and structure |
| >pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 | Back alignment and structure |
| >pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 | Back alignment and structure |
| >pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 | Back alignment and structure |
| >pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 | Back alignment and structure |
| >pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 | Back alignment and structure |
| >pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 | Back alignment and structure |
| >pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 | Back alignment and structure |
| >pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 | Back alignment and structure |
| >pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 | Back alignment and structure |
| >pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 | Back alignment and structure |
| >pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 | Back alignment and structure |
| >pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 | Back alignment and structure |
| >pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 | Back alignment and structure |
| >pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 | Back alignment and structure |
| >pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 | Back alignment and structure |
| >pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 | Back alignment and structure |
| >pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 | Back alignment and structure |
| >pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 | Back alignment and structure |
| >pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 | Back alignment and structure |
| >pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 | Back alignment and structure |
| >pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 | Back alignment and structure |
| >pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 | Back alignment and structure |
| >pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 | Back alignment and structure |
| >pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 549 | |||
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 1e-50 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 3e-25 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 6e-50 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 2e-25 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 2e-48 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 2e-26 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 2e-45 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 5e-22 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 3e-43 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 2e-20 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 5e-39 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 5e-19 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 6e-27 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 3e-22 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 1e-14 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 7e-10 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 2e-04 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 2e-08 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 1e-05 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 2e-05 |
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 | Back alignment and structure |
|---|
Score = 170 bits (430), Expect = 1e-50
Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 1/125 (0%)
Query: 198 AVPIPQIYTMSGRGK-GGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVY 256
+ + +MSGRGK GGKA+AK+KTRSSRAGLQFPVGR+HRLLRKGNY+ERVGAGAPVY
Sbjct: 11 SSGLVPRGSMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVY 70
Query: 257 LAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPN 316
LAAV+EYL AE+LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLL VTIAQGGVLPN
Sbjct: 71 LAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN 130
Query: 317 IQAGL 321
IQA L
Sbjct: 131 IQAVL 135
|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 549 | |||
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 100.0 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 100.0 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 100.0 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 100.0 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 100.0 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 100.0 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 100.0 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 100.0 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 100.0 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 100.0 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 100.0 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 100.0 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 100.0 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 99.97 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.83 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.83 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.75 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.71 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.57 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.54 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.52 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.48 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.46 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.42 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.42 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.4 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.37 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.36 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.25 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.76 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 98.33 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 98.14 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 98.14 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 98.06 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 97.85 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 97.78 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 97.72 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 97.68 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 97.52 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 97.41 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 97.31 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 97.14 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 97.07 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 96.79 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 96.61 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 96.33 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 96.31 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 96.29 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 95.45 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 95.45 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 95.41 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 95.34 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 95.31 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 95.31 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 95.06 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 94.98 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 94.7 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 94.6 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 93.24 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 93.24 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 91.56 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 91.12 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 90.47 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 89.97 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 89.87 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 89.67 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 89.35 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 89.2 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 88.97 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 88.81 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 88.02 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 87.85 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 87.57 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 87.37 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 87.14 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 86.83 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 86.44 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 86.16 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 85.83 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 84.9 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 84.63 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 83.94 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 83.73 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 82.57 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 81.63 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 80.77 |
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-41 Score=301.21 Aligned_cols=119 Identities=62% Similarity=0.949 Sum_probs=106.6
Q ss_pred ccCCCCCCCCCCccCCccccccccccchhhhhhhhcCCcccccCCChhHHHHHHHHHHHHHHHHHHHHHhhhcCCcccch
Q psy7393 207 MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP 286 (549)
Q Consensus 207 MSgrgk~gk~~~k~~SrSsRAGLqFPVsRI~RlLke~~ya~RIsssApVYLAAVLEYLtaEILELAGn~Ar~~kkkRITP 286 (549)
|||+| +|++++++|||+||||||||+||+||||+++|+.||+++|||||+||||||++||+|+|+|+|+++++++|+|
T Consensus 1 m~~~~--~~~~~~~~srs~ragLqfPV~ri~R~Lk~~~~a~RV~~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~~rItp 78 (120)
T 2f8n_G 1 MSSRG--GKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTP 78 (120)
T ss_dssp -----------CCCCCHHHHHTCSSCHHHHHHHHHHHSSSCEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECH
T ss_pred CCCCC--CCCCcCCcCcccccCccCChHHHHHHHHcCccccccccchHHHHHHHHHHHHHHHHHHHHHHHhhcCCceEcH
Confidence 88876 5666788999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhhhcCcHHHHhhhcCceeccccccCCccccccccccc
Q psy7393 287 RHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGLKAEFSI 327 (549)
Q Consensus 287 rHI~lAI~NDeEL~~Lfk~vtIs~GGVlP~I~~~ll~kK~~ 327 (549)
+||++||+||+|||+||+++||++|||+|+||++|++||+.
T Consensus 79 ~hi~lAI~nDeEL~~Ll~~vtia~ggv~p~i~~~l~~k~~~ 119 (120)
T 2f8n_G 79 RHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRG 119 (120)
T ss_dssp HHHHHHHHTSHHHHHHTTTEEETTCCCCCCCCGGGSCCC--
T ss_pred HHHHHHHhcCHHHHHHhCCceECCCCcCCCcCHHHcCCccC
Confidence 99999999999999999999999999999999999999864
|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 549 | ||||
| d1tzya_ | 106 | a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) | 1e-56 | |
| d1tzya_ | 106 | a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) | 3e-30 | |
| d1u35c1 | 106 | a.22.1.1 (C:814-919) macro-H2A.1, histone domain { | 4e-55 | |
| d1u35c1 | 106 | a.22.1.1 (C:814-919) macro-H2A.1, histone domain { | 4e-30 | |
| d1f66c_ | 103 | a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v | 1e-46 | |
| d1f66c_ | 103 | a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v | 3e-26 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 1e-43 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 7e-27 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 3e-24 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 1e-17 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 1e-20 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 9e-12 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 4e-14 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 5e-11 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 4e-09 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 5e-08 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Score = 182 bits (464), Expect = 1e-56
Identities = 94/103 (91%), Positives = 99/103 (96%)
Query: 219 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARD 278
K+K+RSSRAGLQFPVGR+HRLLRKGNYAERVGAGAPVYLAAV+EYL AE+LELAGNAARD
Sbjct: 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD 60
Query: 279 NKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGL 321
NKKTRIIPRHLQLAIRNDEELNKLL VTIAQGGVLPNIQA L
Sbjct: 61 NKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVL 103
|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 549 | |||
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 100.0 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 100.0 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 100.0 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 100.0 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.9 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.88 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.64 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.33 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.22 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.06 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 98.81 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.68 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 98.21 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 98.16 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 98.09 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 97.91 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 97.87 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 97.72 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 97.63 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 97.29 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 97.21 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 97.14 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 96.55 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 95.97 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 95.82 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 94.7 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 94.18 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 91.79 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 91.04 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 88.08 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=2.5e-41 Score=294.92 Aligned_cols=106 Identities=89% Similarity=1.259 Sum_probs=103.8
Q ss_pred ccCCccccccccccchhhhhhhhcCCcccccCCChhHHHHHHHHHHHHHHHHHHHHHhhhcCCcccchhhhhhhhcCcHH
Q psy7393 219 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEE 298 (549)
Q Consensus 219 k~~SrSsRAGLqFPVsRI~RlLke~~ya~RIsssApVYLAAVLEYLtaEILELAGn~Ar~~kkkRITPrHI~lAI~NDeE 298 (549)
|.+|||+||||||||+||+|+||+++|++||+++|||||+||||||++||||+|||+|++++++||||+||++||+||+|
T Consensus 1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDee 80 (106)
T d1tzya_ 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE 80 (106)
T ss_dssp CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHH
T ss_pred CCccccccCCccCChHHHHHHHHcCccccccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHH
Confidence 45799999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhcCceeccccccCCcccccccc
Q psy7393 299 LNKLLSGVTIAQGGVLPNIQAGLKAE 324 (549)
Q Consensus 299 L~~Lfk~vtIs~GGVlP~I~~~ll~k 324 (549)
|+.||+++||++|||+|+||++|++|
T Consensus 81 L~~L~~~vtI~~GGv~P~Ih~~Llpk 106 (106)
T d1tzya_ 81 LNKLLGKVTIAQGGVLPNIQAVLLPK 106 (106)
T ss_dssp HHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred HHHHHcCCeecCCCccCccCHhhcCC
Confidence 99999999999999999999999987
|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|