Diaphorina citri psyllid: psy7416

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
TLEERAQRLFSTKGKTALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLAEQVSEQRSATKDNVQRKQARGEGERGDSEESEAGDTSDEDDEKEAGSVLTHVGAHLDLSAFSSWEELASLGLDRLKTLEERAQRLFSTKGKTALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLAEQVSEQRSATKDNVQRKQARGEGERGDSEESEAGDTSDEDDEVPYNPKNLPLGWDGKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDALALWEKLKAQKQEERWQPEQEEEFEDSLGNVVNRKTYEDLKRQGWQPEQEEEFEDSLGNVVNRKTYEDLKRQGLL
cHHHHHHHHHHccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEccEEccccccccHHHHHHHcccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHccccccccHHHHHHHHcccc
TLEERAQRLFSTKGKTAL*************************AGLEAQIYKLAEQVSE**********************************************VGAHLDLSAFSSWEELASLGLDRLKTLEERA************************************IAGLEAQIYKLAEQVSEQRSATKDNVQ******************************NPKNLPLGWDGKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDALALWEKL****************FEDSLGNVVNRKTYEDLKRQGWQPEQEEEFEDSLGNVVNRKTYEDLKR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TLEERAQRLFSTKGKTALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLxxxxxxxxxxxxxxxxxxxxxGEGERGDSEESEAGDTSDEDDEKEAGSVLTHVGAHLDLSAFSSWEELASLGLDRLKTLEERAQRLFSTKGKTALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLxxxxxxxxxxxxxxxxxxxxxGEGERGDSEESEAGDTSDEDDEVPYNPKNLPLGWDGKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANxxxxxxxxxxxxxxxxxxxxxRWQPEQEEEFEDSLGNVVNRKTYEDLKRQGWQPEQEEEFEDSLGNVVNRKTYEDLKRQGLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 3A subunit 3 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.confidentQ12874
Splicing factor 3A subunit 3 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.confidentQ9D554
Splicing factor 3A subunit 3 Probable subunit of a splicing factor complex required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA (By similarity). Involved in male fertility.confidentO46106

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DGW, chain A
Confidence level:very confident
Coverage over the Query: 134-213
View the alignment between query and template
View the model in PyMOL
Template: 4DGW, chain A
Confidence level:very confident
Coverage over the Query: 4-26,37-83
View the alignment between query and template
View the model in PyMOL
Template: 2M0E, chain A
Confidence level:probable
Coverage over the Query: 255-277
View the alignment between query and template
View the model in PyMOL