Diaphorina citri psyllid: psy744


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----
MTRESALLRRSSLDPDRRRLSLGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDETSSDSEVPVDPDLASSDDKVFEENEEPRDYVQNSCWGEVPVSDSQIIKI
ccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHccccCECcccccccEEEEccHHHHHHHHHHHHHccccEEEEECccccEEEEEccHHHHHHHHHHHcccccccHHHHccccHHHHHHcccccEEEEEcccccEEEEEEHHHHHHHHHHHcccccccccccccHHHcccccccccEEEcccccHHHHHHHHHHccccccEEEcccccEEEEEEHHHHHHHHHHcccccccccHHHHHHcccccccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccc
***************************************HAVNAAVLF*DS*****ATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLK***********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRESALLRRSSLDPDRRRLSLGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDETSSDSEVPVDPDLASSDDKVFEENEEPRDYVQNSCWGEVPVSDSQIIKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5'-AMP-activated protein kinase subunit gamma-2 AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.confidentQ91WG5
5'-AMP-activated protein kinase subunit gamma Adenine nucleotides-binding subunit gamma of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (SNF1) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits.confidentP12904
5'-AMP-activated protein kinase subunit gamma-2 AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.confidentQ5R4S0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031588 [CC]AMP-activated protein kinase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0030295 [MF]protein kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006110 [BP]regulation of glycolysisprobableGO:0043470, GO:0043471, GO:0043467, GO:0031329, GO:0060255, GO:0031323, GO:0009894, GO:0050794, GO:0010906, GO:0065007, GO:0010675, GO:0008150, GO:0019222, GO:0006109, GO:0050789, GO:0080090
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0009267 [BP]cellular response to starvationprobableGO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0042595 [BP]behavioral response to starvationprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150, GO:0042594
GO:0008603 [MF]cAMP-dependent protein kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0008607 [MF]phosphorylase kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016208 [MF]AMP bindingprobableGO:0043168, GO:0043169, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:2001020 [BP]regulation of response to DNA damage stimulusprobableGO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0046320 [BP]regulation of fatty acid oxidationprobableGO:0080090, GO:0019217, GO:0019216, GO:0031323, GO:0010565, GO:0050794, GO:0065007, GO:0008150, GO:0019222, GO:0050789
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005977 [BP]glycogen metabolic processprobableGO:0044042, GO:0044238, GO:0044264, GO:0044262, GO:0015980, GO:0044260, GO:0005976, GO:0009987, GO:0044710, GO:0044237, GO:0043170, GO:0008152, GO:0071704, GO:0006112, GO:0008150, GO:0006073, GO:0005975, GO:0006091, GO:0055114
GO:0031974 [CC]membrane-enclosed lumenprobableGO:0005575
GO:0043531 [MF]ADP bindingprobableGO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004862 [MF]cAMP-dependent protein kinase inhibitor activityprobableGO:0019210, GO:0019207, GO:0019887, GO:0030234, GO:0004860, GO:0003674, GO:0030291, GO:0004857
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0010800 [BP]positive regulation of peptidyl-threonine phosphorylationprobableGO:0019220, GO:0080090, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0009893, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0010799, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0042632 [BP]cholesterol homeostasisprobableGO:0042592, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0065008, GO:0055092
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0045860 [BP]positive regulation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0030730 [BP]sequestering of triglycerideprobableGO:0065008, GO:0008150, GO:0019915, GO:0065007, GO:0051235, GO:0033036, GO:0010876, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V8Q, chain E
Confidence level:very confident
Coverage over the Query: 73-346
View the alignment between query and template
View the model in PyMOL
Template: 2V8Q, chain E
Confidence level:very confident
Coverage over the Query: 166-400
View the alignment between query and template
View the model in PyMOL