Psyllid ID: psy744


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----
MTRESALLRRSSLDPDRRRLSLGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDETSSDSEVPVDPDLASSDDKVFEENEEPRDYVQNSCWGEVPVSDSQIIKI
ccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHccccEEEcccccccEEEEccHHHHHHHHHHHHHccccEEEEEEccccEEEEEccHHHHHHHHHHHcccccccHHHHccccHHHHHHcccccEEEEEcccccEEEEEEHHHHHHHHHHHccccccccccccHHHHHccccccccEEEcccccHHHHHHHHHHccccccEEEcccccEEEEEEHHHHHHHHHHcccccccccHHHHHHcccccccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccc
cccccccHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHcHHHHHHHHHHHHcccccEcccccEEEEEcccHHHHHHHHHHHHccccEccccccccccEEEEEEHHHHHHHHHHHHccccccEcccccccccHHHHHHcccEccEEcccccEEEEEEHHHHHHHHHHHHHcccccHHHcccHHHccccccccEEEEccccHHHHHHHHHHHHcccccEEEccccEEEEHHHHHHHHHHHHccccccccEEHHHHHHHcccccccEEEEcccccHHHHHHHHHHcccEEEEEEEcccEEEEEEEHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccEEEc
mtresallrrssldpdrrrlslgtvnssyrgssdllDLHHAVNAAVLfrdsrglpvatsfldkidfadlekdggnQIFVKFFKfhkcydliptsaklvvFDTQLLVKKAFFALVYNGiraaplwdsVHQQYVGMLTITDFIKILQMYytsssitmeELEEHKLEtnlidykihrlpvideMGNVLYILTHKRILRFLFLYindlpkpsflnktlrdlkigtyenvetVAEETSIIHALRKFLERRVsalpmtdseghlvDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLvvvdeddhvlGVLSLSDILVYLVLkpsdddigvdetssdsevpvdpdlassddkvfeeneeprdyvqnscwgevpvsdsqiiki
mtresallrrssldpdrrrlslgtvnssyrgssDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDetssdsevpvdpdlassddKVFEENeeprdyvqnscwgevpvsdsqiiki
MTRESAllrrssldpdrrrlslGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDETSSDSEVPVDPDLASSDDKVFEENEEPRDYVQNSCWGEVPVSDSQIIKI
*********************************DLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLK********************************************CWG************
****************************************************************************IFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVL********************************************************IIKI
**********SSLDPDRRRLSLGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDI****************LASSDDKVFEENEEPRDYVQNSCWGEVPV********
***************************************HAVNAAVLF*DS*****ATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPS*********************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRESALLRRSSLDPDRRRLSLGTVNSSYRGSSDLLDLHHAVNAAVLFRDSRGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETNLIDYKIHRLPVIDEMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKPSDDDIGVDETSSDSEVPVDPDLASSDDKVFEENEEPRDYVQNSCWGEVPVSDSQIIKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query405 2.2.26 [Sep-21-2011]
Q91WG5566 5'-AMP-activated protein yes N/A 0.733 0.524 0.533 2e-96
Q5R4S0524 5'-AMP-activated protein yes N/A 0.735 0.568 0.527 2e-95
Q9UGJ0569 5'-AMP-activated protein yes N/A 0.735 0.523 0.528 8e-95
Q09138330 5'-AMP-activated protein no N/A 0.676 0.830 0.576 3e-92
P54619331 5'-AMP-activated protein no N/A 0.676 0.827 0.576 3e-92
P58108330 5'-AMP-activated protein no N/A 0.676 0.830 0.576 4e-92
O54950330 5'-AMP-activated protein no N/A 0.676 0.830 0.576 5e-92
P80385330 5'-AMP-activated protein no N/A 0.676 0.830 0.569 7e-91
Q9MYP4514 5'-AMP-activated protein no N/A 0.802 0.632 0.457 5e-81
Q9UGI9489 5'-AMP-activated protein no N/A 0.713 0.591 0.485 1e-80
>sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 Back     alignment and function desciption
 Score =  352 bits (904), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 237/330 (71%), Gaps = 33/330 (10%)

Query: 61  LDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRA 120
           L+K++F + E+D  + ++++F + HKCYD++PTS+KLVVFDT L VKKAFFALV NG+RA
Sbjct: 242 LEKLEFQE-EEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRA 300

Query: 121 APLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLET--------------- 165
           APLW+S  Q +VGMLTITDFI IL  YY S  + + ELEEHK+ET               
Sbjct: 301 APLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVN 360

Query: 166 ------------NLIDYKIHRLPVIDEM-GNVLYILTHKRILRFLFLYINDLPKPSFLNK 212
                       +LI  KIHRLPVID + GN LYILTHKRIL+FL L+++D+PKP+F+ +
Sbjct: 361 ISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQ 420

Query: 213 TLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAA 272
            L +L IGTY N+  +  +T II AL  F+ERR+SALP+ D  G +VDI++KFDVINLAA
Sbjct: 421 NLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAA 480

Query: 273 EKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLG 332
           EKTY NLD+T+ +A +H++ +FEGV KC   ETL T+++RIVRAEVHRLVVV+E D ++G
Sbjct: 481 EKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVG 540

Query: 333 VLSLSDILVYLVLKPSDDDIGVDETSSDSE 362
           ++SLSDIL  L+L P+    G  +  +++E
Sbjct: 541 IISLSDILQALILTPA----GAKQKETETE 566




AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
Mus musculus (taxid: 10090)
>sp|Q5R4S0|AAKG2_PONAB 5'-AMP-activated protein kinase subunit gamma-2 OS=Pongo abelii GN=PRKAG2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UGJ0|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1 Back     alignment and function description
>sp|Q09138|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2 Back     alignment and function description
>sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1 Back     alignment and function description
>sp|P58108|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2 Back     alignment and function description
>sp|O54950|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2 Back     alignment and function description
>sp|P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus GN=Prkag1 PE=1 SV=3 Back     alignment and function description
>sp|Q9MYP4|AAKG3_PIG 5'-AMP-activated protein kinase subunit gamma-3 OS=Sus scrofa GN=PRKAG3 PE=1 SV=2 Back     alignment and function description
>sp|Q9UGI9|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query405
242008127 770 AMP-activated protein kinase, gamma regu 0.874 0.459 0.697 1e-150
383862359 1183 PREDICTED: uncharacterized protein LOC10 0.864 0.295 0.679 1e-145
24648655 1400 SNF4/AMP-activated protein kinase gamma 0.881 0.255 0.652 1e-144
195454217 1306 GK14491 [Drosophila willistoni] gi|19417 0.879 0.272 0.654 1e-143
307177510 678 5'-AMP-activated protein kinase subunit 0.940 0.561 0.634 1e-143
24648645 947 SNF4/AMP-activated protein kinase gamma 0.881 0.376 0.652 1e-143
27228260 906 loechrig isoform II [Drosophila melanoga 0.888 0.397 0.650 1e-142
4007492 647 SNF4/AMP-activated protein kinase gamma 0.881 0.551 0.652 1e-142
24648657 906 SNF4/AMP-activated protein kinase gamma 0.888 0.397 0.647 1e-142
328719052 816 PREDICTED: hypothetical protein LOC10016 0.849 0.421 0.691 1e-142
>gi|242008127|ref|XP_002424864.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Pediculus humanus corporis] gi|212508414|gb|EEB12126.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 272/390 (69%), Positives = 319/390 (81%), Gaps = 36/390 (9%)

Query: 1   MTRESALLRRSSLDPDRRRLSLGTVNSSY---RGSSDLLDLHHAVNAAVLFRDSRGLPVA 57
           + +E ALLRRSSLDP+RRRLSLG VNS++   R S   LD HHA   A+LFRDSRGLPVA
Sbjct: 345 IVKEGALLRRSSLDPERRRLSLGPVNSAHGPHRASDAFLDPHHA---AILFRDSRGLPVA 401

Query: 58  TSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNG 117
             FL+K++ +DLE+D  +QIFVKFF+FHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNG
Sbjct: 402 DPFLEKVNMSDLEEDE-SQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNG 460

Query: 118 IRAAPLWDSVHQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLET------------ 165
           +RAAPLWDSV Q++VGMLTITDFIKIL+MYYTS S+TM+ELEEHKL+T            
Sbjct: 461 VRAAPLWDSVKQKFVGMLTITDFIKILRMYYTSPSVTMDELEEHKLDTWRNVLKVLPLVY 520

Query: 166 ------------NLIDYKIHRLPVID-EMGNVLYILTHKRILRFLFLYINDLPKPSFLNK 212
                        LI+ +IHRLPVID E GNVLYILTHKRILRFLFLYINDLPKPS++NK
Sbjct: 521 ISPDSSLYDAIKTLINNRIHRLPVIDPETGNVLYILTHKRILRFLFLYINDLPKPSYMNK 580

Query: 213 TLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAA 272
           TL +LKIGT+E +ET  E+TSII AL+KF+ERRVSALPM D +G LVDIFAKFDVINLAA
Sbjct: 581 TLGELKIGTFEGIETATEDTSIILALKKFVERRVSALPMIDKDGKLVDIFAKFDVINLAA 640

Query: 273 EKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLG 332
           EKTY NLDV+LK+ANEH+ +WFEGV+KC LDE LFT+MERIVRAEVHRLVVVD+ D V+G
Sbjct: 641 EKTYNNLDVSLKKANEHRNEWFEGVQKCTLDEKLFTIMERIVRAEVHRLVVVDDSDKVIG 700

Query: 333 VLSLSDILVYLVLKPSDDDIGVDETSSDSE 362
           ++SLSD+L +LVLKP     G + +++DSE
Sbjct: 701 IISLSDLLFHLVLKPG----GENGSAADSE 726




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383862359|ref|XP_003706651.1| PREDICTED: uncharacterized protein LOC100882269 [Megachile rotundata] Back     alignment and taxonomy information
>gi|24648655|ref|NP_732598.1| SNF4/AMP-activated protein kinase gamma subunit, isoform F [Drosophila melanogaster] gi|281362196|ref|NP_001163671.1| SNF4/AMP-activated protein kinase gamma subunit, isoform R [Drosophila melanogaster] gi|281362198|ref|NP_001163672.1| SNF4/AMP-activated protein kinase gamma subunit, isoform S [Drosophila melanogaster] gi|17944235|gb|AAL48012.1| LD22662p [Drosophila melanogaster] gi|23171854|gb|AAF55864.2| SNF4/AMP-activated protein kinase gamma subunit, isoform F [Drosophila melanogaster] gi|27228258|gb|AAN85714.1| loechrig isoform I [Drosophila melanogaster] gi|272477084|gb|ACZ94967.1| SNF4/AMP-activated protein kinase gamma subunit, isoform R [Drosophila melanogaster] gi|272477085|gb|ACZ94968.1| SNF4/AMP-activated protein kinase gamma subunit, isoform S [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195454217|ref|XP_002074141.1| GK14491 [Drosophila willistoni] gi|194170226|gb|EDW85127.1| GK14491 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|307177510|gb|EFN66621.1| 5'-AMP-activated protein kinase subunit gamma-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|24648645|ref|NP_732594.1| SNF4/AMP-activated protein kinase gamma subunit, isoform A [Drosophila melanogaster] gi|24648647|ref|NP_536757.2| SNF4/AMP-activated protein kinase gamma subunit, isoform B [Drosophila melanogaster] gi|23171850|gb|AAN13851.1| SNF4/AMP-activated protein kinase gamma subunit, isoform A [Drosophila melanogaster] gi|23171851|gb|AAF55860.2| SNF4/AMP-activated protein kinase gamma subunit, isoform B [Drosophila melanogaster] gi|28317244|gb|AAO39629.1| GH01416p [Drosophila melanogaster] gi|33636507|gb|AAQ23551.1| RE59472p [Drosophila melanogaster] gi|220956698|gb|ACL90892.1| SNF4Agamma-PA [synthetic construct] gi|288558774|gb|ADC53518.1| FI14001p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|27228260|gb|AAN85715.1| loechrig isoform II [Drosophila melanogaster] gi|27228266|gb|AAN85718.1| loechrig isoform V [Drosophila melanogaster] gi|27228268|gb|AAN85719.1| loechrig isoform VI [Drosophila melanogaster] gi|27228270|gb|AAN85720.1| loechrig isoform VII [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|4007492|gb|AAC95306.1| SNF4/AMP-activated protein kinase gamma subunit [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24648657|ref|NP_732599.1| SNF4/AMP-activated protein kinase gamma subunit, isoform C [Drosophila melanogaster] gi|24648659|ref|NP_732600.1| SNF4/AMP-activated protein kinase gamma subunit, isoform E [Drosophila melanogaster] gi|116008060|ref|NP_001036737.1| SNF4/AMP-activated protein kinase gamma subunit, isoform K [Drosophila melanogaster] gi|116008062|ref|NP_001036738.1| SNF4/AMP-activated protein kinase gamma subunit, isoform J [Drosophila melanogaster] gi|281362192|ref|NP_001163669.1| SNF4/AMP-activated protein kinase gamma subunit, isoform P [Drosophila melanogaster] gi|281362194|ref|NP_001163670.1| SNF4/AMP-activated protein kinase gamma subunit, isoform Q [Drosophila melanogaster] gi|19527523|gb|AAL89876.1| RE22690p [Drosophila melanogaster] gi|23171855|gb|AAN13852.1| SNF4/AMP-activated protein kinase gamma subunit, isoform C [Drosophila melanogaster] gi|23171856|gb|AAN13853.1| SNF4/AMP-activated protein kinase gamma subunit, isoform E [Drosophila melanogaster] gi|113194808|gb|ABI31188.1| SNF4/AMP-activated protein kinase gamma subunit, isoform K [Drosophila melanogaster] gi|113194809|gb|ABI31189.1| SNF4/AMP-activated protein kinase gamma subunit, isoform J [Drosophila melanogaster] gi|220948160|gb|ACL86623.1| SNF4Agamma-PC [synthetic construct] gi|272477082|gb|ACZ94965.1| SNF4/AMP-activated protein kinase gamma subunit, isoform P [Drosophila melanogaster] gi|272477083|gb|ACZ94966.1| SNF4/AMP-activated protein kinase gamma subunit, isoform Q [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|328719052|ref|XP_001943206.2| PREDICTED: hypothetical protein LOC100169066 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query405
FB|FBgn0264357 1400 SNF4Agamma "SNF4/AMP-activated 0.491 0.142 0.705 3.1e-124
UNIPROTKB|F1LLY5528 Prkag2 "Protein Prkag2" [Rattu 0.451 0.346 0.597 1.7e-90
MGI|MGI:1336153566 Prkag2 "protein kinase, AMP-ac 0.451 0.323 0.597 2.7e-90
UNIPROTKB|Q9UGJ0569 PRKAG2 "5'-AMP-activated prote 0.451 0.321 0.592 9e-90
RGD|727782326 Prkag2 "protein kinase, AMP-ac 0.451 0.561 0.597 3e-89
UNIPROTKB|F1NXL4565 PRKAG2 "Uncharacterized protei 0.476 0.341 0.570 2.7e-88
UNIPROTKB|F1SSN2331 PRKAG2 "Uncharacterized protei 0.451 0.552 0.597 1.5e-87
UNIPROTKB|F1MH48330 PRKAG1 "5'-AMP-activated prote 0.446 0.548 0.609 3.9e-87
UNIPROTKB|P58108330 PRKAG1 "5'-AMP-activated prote 0.446 0.548 0.609 3.9e-87
UNIPROTKB|Q09138330 PRKAG1 "5'-AMP-activated prote 0.446 0.548 0.609 3.9e-87
FB|FBgn0264357 SNF4Agamma "SNF4/AMP-activated protein kinase gamma subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 733 (263.1 bits), Expect = 3.1e-124, Sum P(2) = 3.1e-124
 Identities = 141/200 (70%), Positives = 174/200 (87%)

Query:   167 LIDYKIHRLPVIDEM-GNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENV 225
             LI  +IHRLPVID   GNVLYILTHKRILRFLFLYIN+LPKP+++ K+LR+LKIGTY N+
Sbjct:  1039 LIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNI 1098

Query:   226 ETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTLKE 285
             ET  E TSII AL+KF+ERRVSALP+ DS+G LVDI+AKFDVINLAAEKTY +LDV+L++
Sbjct:  1099 ETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRK 1158

Query:   286 ANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVL 345
             ANEH+ +WFEGV+KC LDE+L+T+MERIVRAEVHRLVVVDE+  V+G++SLSDIL+YLVL
Sbjct:  1159 ANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVL 1218

Query:   346 KPSDDDIGVDETSSDSEVPV 365
             +PS + +G  E+S  +  PV
Sbjct:  1219 RPSGEGVGGSESSLRASDPV 1238


GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0006468 "protein phosphorylation" evidence=ISS
GO:0004679 "AMP-activated protein kinase activity" evidence=ISS;NAS
GO:0042632 "cholesterol homeostasis" evidence=IMP
GO:0045787 "positive regulation of cell cycle" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0006914 "autophagy" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:2001020 "regulation of response to DNA damage stimulus" evidence=IGI
GO:0009267 "cellular response to starvation" evidence=IMP
GO:0030730 "sequestering of triglyceride" evidence=IMP
GO:0006629 "lipid metabolic process" evidence=IMP
GO:0042595 "behavioral response to starvation" evidence=IMP
UNIPROTKB|F1LLY5 Prkag2 "Protein Prkag2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1336153 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UGJ0 PRKAG2 "5'-AMP-activated protein kinase subunit gamma-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|727782 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXL4 PRKAG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSN2 PRKAG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MH48 PRKAG1 "5'-AMP-activated protein kinase subunit gamma-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P58108 PRKAG1 "5'-AMP-activated protein kinase subunit gamma-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q09138 PRKAG1 "5'-AMP-activated protein kinase subunit gamma-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91WG5AAKG2_MOUSENo assigned EC number0.53330.73330.5247yesN/A
P12904AAKG_YEASTNo assigned EC number0.32100.64930.8167yesN/A
Q5R4S0AAKG2_PONABNo assigned EC number0.52720.73580.5687yesN/A
Q10343AAKG_SCHPONo assigned EC number0.32080.69380.8413yesN/A
Q9UGJ0AAKG2_HUMANNo assigned EC number0.52870.73580.5237yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after 1e-45
cd0461898 cd04618, CBS_pair_5, The CBS domain, named after h 3e-31
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 1e-14
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after 1e-10
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 5e-10
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 9e-10
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-09
cd04627123 cd04627, CBS_pair_14, The CBS domain, named after 2e-08
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 2e-07
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 2e-07
cd04593115 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con 2e-07
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 2e-07
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 3e-07
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 3e-07
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 3e-07
pfam0057157 pfam00571, CBS, CBS domain 5e-07
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 5e-07
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 8e-07
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 1e-06
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two 2e-06
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 2e-06
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 2e-06
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 2e-06
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 2e-06
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 2e-06
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 3e-06
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 5e-06
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after 5e-06
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 9e-06
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 2e-05
cd04801114 cd04801, CBS_pair_M50_like, This cd contains two t 2e-05
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 3e-05
pfam0057157 pfam00571, CBS, CBS domain 4e-05
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 9e-05
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 1e-04
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 1e-04
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 2e-04
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 2e-04
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 6e-04
cd04589111 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd 6e-04
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 7e-04
COG2524294 COG2524, COG2524, Predicted transcriptional regula 8e-04
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 0.002
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after 0.002
cd04639111 cd04639, CBS_pair_26, The CBS domain, named after 0.002
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai 0.004
>gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score =  152 bits (387), Expect = 1e-45
 Identities = 61/119 (51%), Positives = 83/119 (69%)

Query: 224 NVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTL 283
           N+ T   +T +I  L   +ERRVSALP+ D  G +VD++++FDVINLA E  Y NLD+T+
Sbjct: 2   NIATARPDTPLIDVLDMLVERRVSALPIVDENGKVVDVYSRFDVINLAKEGAYNNLDLTV 61

Query: 284 KEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVY 342
            EA E ++  FEGV  C  D+ L T+ + IV+A VHRLVVVDE+  V G++SLSDIL +
Sbjct: 62  GEALERRSQDFEGVRTCSPDDCLRTIFDLIVKARVHRLVVVDENKRVEGIISLSDILQF 120


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 120

>gnl|CDD|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 405
KOG1764|consensus381 100.0
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.89
COG2524294 Predicted transcriptional regulator, contains C-te 99.78
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.73
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.72
COG2524294 Predicted transcriptional regulator, contains C-te 99.66
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.66
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.66
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.64
COG3620187 Predicted transcriptional regulator with C-termina 99.62
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.62
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.61
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.6
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.59
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.59
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.59
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.59
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.58
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.58
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.58
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.58
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.57
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.57
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.57
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.56
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.56
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.56
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.56
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.55
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.55
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.55
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.55
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.55
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.54
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.54
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.54
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.54
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.53
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.53
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.53
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.52
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.52
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.52
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.52
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.52
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.52
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.52
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.51
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.51
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.51
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.51
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.51
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.51
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.5
PRK11573413 hypothetical protein; Provisional 99.5
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.5
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.5
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.5
COG2905 610 Predicted signal-transduction protein containing c 99.5
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.5
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.49
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.48
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.48
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.48
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.48
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.47
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.47
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.46
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.46
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.45
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.45
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.45
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.45
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.45
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.44
COG3620187 Predicted transcriptional regulator with C-termina 99.42
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.42
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.42
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.42
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 99.42
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.42
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.41
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.41
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.41
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.41
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.39
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.39
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.38
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.38
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.37
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.37
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.37
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.37
COG0517117 FOG: CBS domain [General function prediction only] 99.36
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.36
COG4109432 Predicted transcriptional regulator containing CBS 99.36
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.35
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.35
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.34
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.34
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.33
COG1253429 TlyC Hemolysins and related proteins containing CB 99.33
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.33
KOG1764|consensus381 99.32
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.31
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.31
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.31
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.3
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.3
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.29
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.29
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.29
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.29
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.29
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.28
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.27
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.27
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.27
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.26
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.26
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.26
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.25
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.25
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.25
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.24
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.24
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.24
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.24
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.24
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.24
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.23
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.23
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.22
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.22
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.22
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.22
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.22
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.21
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.21
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.21
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.21
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.21
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.2
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.2
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.2
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.2
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.2
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.19
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.18
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.18
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.18
PRK11573413 hypothetical protein; Provisional 99.17
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.17
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.16
COG0517117 FOG: CBS domain [General function prediction only] 99.16
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.16
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.15
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.15
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.14
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.13
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.13
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.12
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.12
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.11
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.11
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.1
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.1
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.09
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.09
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.08
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.07
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.07
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.06
COG2905 610 Predicted signal-transduction protein containing c 99.06
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.06
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.05
COG4109432 Predicted transcriptional regulator containing CBS 99.01
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.0
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 98.98
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.97
COG1253429 TlyC Hemolysins and related proteins containing CB 98.96
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.94
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 98.93
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.82
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.81
KOG2550|consensus 503 98.79
COG4175386 ProV ABC-type proline/glycine betaine transport sy 98.73
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 98.61
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.45
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.42
PRK14869546 putative manganese-dependent inorganic pyrophospha 98.4
KOG0474|consensus762 98.38
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.24
KOG0474|consensus762 98.2
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.12
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.06
smart0011649 CBS Domain in cystathionine beta-synthase and othe 98.02
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.02
KOG2550|consensus 503 97.9
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.77
KOG0475|consensus696 97.51
KOG0475|consensus696 96.92
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 96.53
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 95.38
KOG0476|consensus931 95.32
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 95.2
COG4175386 ProV ABC-type proline/glycine betaine transport sy 93.91
KOG0476|consensus 931 92.7
>KOG1764|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-34  Score=281.75  Aligned_cols=301  Identities=53%  Similarity=0.815  Sum_probs=262.5

Q ss_pred             CCCcccCCcCcccchhhhhccchhHHHHHHhhhcccccccCCCCCeEEEeCCccHHHHHHHHHHcCCceeeeEeCCCCee
Q psy744           52 RGLPVATSFLDKIDFADLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQY  131 (405)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~d~~p~s~~vv~v~~~~~v~~A~~~m~~~~i~~~PV~d~~~~~~  131 (405)
                      ..+|....+....+............|.+|+..++||+++|++.++++++..+++.+|+..|..++++++|+||...+++
T Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~~~~~  112 (381)
T KOG1764|consen   33 SRRPEASPFLVSENEVETAESNAVDTLSKFMKSHTCYDLLPTSSKLVVFDTKLSVKKAFNALVQNGVRAAPLWDSKKQQF  112 (381)
T ss_pred             hccccccccccccccccccccchhHHHHHHHhccCcccccCCcceeEEeeCCCcHHHHHHHHHhhceeeeccccCcccee
Confidence            33444444444445555556666778999999999999999999999999999999999999999999999999998999


Q ss_pred             eeEEeHHHHHHHHHHhhCCCC--CCHHHHhhc------------------c------------HHHHHHhcCCCEEEEEe
Q psy744          132 VGMLTITDFIKILQMYYTSSS--ITMEELEEH------------------K------------LETNLIDYKIHRLPVID  179 (405)
Q Consensus       132 ~GilT~~Dil~~l~~~~~~~~--~~~~~l~~~------------------~------------i~~~l~~~~i~~lpVvd  179 (405)
                      +|++|+.||+..+..++..+.  .....+...                  +            ....+.+++++++||+|
T Consensus       113 ~g~~~~~d~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d  192 (381)
T KOG1764|consen  113 VGMLTITDFITVLLRYYKSKSSLDNIEVLEDSQLSKRREVECLLKETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVID  192 (381)
T ss_pred             EEEEEHHHHHHHHHHhhccCCcHHHHhhhhhhhccccchhhhhhccccCCCceeecCcHHHHHHHHHHHhCCccceeeec
Confidence            999999999999887776411  111111100                  0            01178999999999999


Q ss_pred             -CCCCEEEEEeHHHHHHHHHHhhCCCCCccccccccccccccccCCeeEEcCCCCHHHHHHHHHhcCCCEEEEECCCCcE
Q psy744          180 -EMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHL  258 (405)
Q Consensus       180 -~~~~vvgilt~~dIl~~l~~~~~~~~~~~~~~~~v~~i~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~l  258 (405)
                       +.+++.+++|++.|+++++.+.+.++...++..++.++.++.+.++..+..++++.+|++.|.+++++++||||..|+.
T Consensus       193 ~~~~~v~~ilt~~rIl~~l~~~~~~~~~~~~l~~s~~dl~ig~~~~i~~i~~~~~v~~al~~m~~~~is~lpvV~~~g~~  272 (381)
T KOG1764|consen  193 PETGEVLYILTQRRILKFLWLNGRLLPLPSLLSKSLSDLGIGTWSNIASISEDTPVIEALKIMSERRISALPVVDENGKK  272 (381)
T ss_pred             ccccceeeehhHHHHHHHHHHhhcccccHHHhhCCHHHhCcchhhhheeecCCCcHHHHHHHHHhcCcCcceEEcCCCce
Confidence             7889999999999999999999988888999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeHHHHHHHHHhccccchhhh-HHHhhhccccCccCceEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeHH
Q psy744          259 VDIFAKFDVINLAAEKTYTNLDVT-LKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLS  337 (405)
Q Consensus       259 vGivt~~Dl~~~~~~~~~~~l~~~-v~~~~~~~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGiIt~~  337 (405)
                      +|+++..|+.....+..+..++.. +.+....+.....++++|.++++|.++++.|..+++|+++|||++|.++|+||.+
T Consensus       273 v~~~s~~Dv~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd~~~~l~GvvSLs  352 (381)
T KOG1764|consen  273 VGNYSRFDVIHLAREGTYNNLDLSCLSEALSHRPIRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVDEDGVLVGVISLS  352 (381)
T ss_pred             ecceehhhhhhhhhcCccCccchhHHHHHhhhcccccCccEEEeecchHHHHHHHHHhcCceEEEEEcCCCcEEEEeeHH
Confidence            999999999999999988888888 8888877777778899999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCC
Q psy744          338 DILVYLVLKPSDDDI  352 (405)
Q Consensus       338 DIl~~l~~~~~~~~~  352 (405)
                      ||+.++...+.+...
T Consensus       353 Dil~~l~~~p~~~~~  367 (381)
T KOG1764|consen  353 DILSYLVLTPSGGTP  367 (381)
T ss_pred             HHHHHHHhCccCCCC
Confidence            999999988876543



>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>KOG1764|consensus Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>KOG0474|consensus Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG0474|consensus Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>KOG0475|consensus Back     alignment and domain information
>KOG0475|consensus Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0476|consensus Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0476|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
2v8q_E330 Crystal Structure Of The Regulatory Fragment Of Mam 6e-92
2uv5_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 2e-42
2uv6_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 7e-42
3t4n_C323 Structure Of The Regulatory Fragment Of Saccharomyc 2e-41
2uv7_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 2e-41
2qlv_C315 Crystal Structure Of The Heterotrimer Core Of The S 2e-41
2qr1_G334 Crystal Structure Of The Adenylate Sensor From Amp- 2e-40
2oox_G333 Crystal Structure Of The Adenylate Sensor From Amp- 2e-40
2nyc_A144 Crystal Structure Of The Bateman2 Domain Of Yeast S 1e-21
2nye_A144 Crystal Structure Of The Bateman2 Domain Of Yeast S 6e-21
>pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330 Back     alignment and structure

Iteration: 1

Score = 334 bits (856), Expect = 6e-92, Method: Compositional matrix adjust. Identities = 172/302 (56%), Positives = 214/302 (70%), Gaps = 28/302 (9%) Query: 72 DGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQY 131 + + ++ F K H+CYDLIPTS+KLVVFDT L VKKAFFALV NG+RAAPLWDS Q + Sbjct: 22 ESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSF 81 Query: 132 VGMLTITDFIKILQMYYTSSSITMEELEEHKLET-------------------------- 165 VGMLTITDFI IL YY S+ + + ELEEHK+ET Sbjct: 82 VGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAV 141 Query: 166 -NLIDYKIHRLPVID-EMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKIGTYE 223 +LI KIHRLPVID E GN LYILTHKRIL+FL L+I + PKP F++K+L +L+IGTY Sbjct: 142 SSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYA 201 Query: 224 NVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTL 283 N+ V T + AL F++ RVSALP+ D +G +VDI++KFDVINLAAEKTY NLDV++ Sbjct: 202 NIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSV 261 Query: 284 KEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYL 343 +A +H++ +FEGV KC L ETL ++ R+V AEVHRLVVVDE D V G++SLSDIL L Sbjct: 262 TKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQAL 321 Query: 344 VL 345 VL Sbjct: 322 VL 323
>pdb|3T4N|C Chain C, Structure Of The Regulatory Fragment Of Saccharomyces Cerevisiae Ampk In Complex With Adp Length = 323 Back     alignment and structure
>pdb|2QLV|C Chain C, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 315 Back     alignment and structure
>pdb|2QR1|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-Activated Protein Kinase In Complex With Adp Length = 334 Back     alignment and structure
>pdb|2OOX|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-activated Protein Kinase Complexed With Amp Length = 333 Back     alignment and structure
>pdb|2NYC|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 Back     alignment and structure
>pdb|2NYE|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 4e-89
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-10
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 5e-88
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 3e-78
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 2e-52
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 3e-05
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 1e-48
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 8e-14
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 2e-12
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 2e-47
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 6e-05
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 3e-04
3ddj_A296 CBS domain-containing protein; structural genomics 2e-43
3ddj_A296 CBS domain-containing protein; structural genomics 1e-17
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 6e-16
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 4e-11
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 3e-08
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 3e-07
1pvm_A184 Conserved hypothetical protein TA0289; structural 1e-15
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 3e-15
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 9e-11
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 7e-05
1o50_A157 CBS domain-containing predicted protein TM0935; CB 4e-15
1o50_A157 CBS domain-containing predicted protein TM0935; CB 3e-11
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 2e-14
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 4e-05
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 8e-14
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 4e-04
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 4e-13
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 1e-06
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 4e-13
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 2e-07
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 5e-13
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 5e-07
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 1e-12
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 2e-12
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 3e-09
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 5e-04
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 4e-12
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 8e-09
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 2e-04
4fry_A157 Putative signal-transduction protein with CBS DOM; 5e-12
1pbj_A125 Hypothetical protein; structural genomics, domain, 1e-11
1pbj_A125 Hypothetical protein; structural genomics, domain, 1e-07
3lqn_A150 CBS domain protein; csgid, structural genomics, un 2e-11
3lqn_A150 CBS domain protein; csgid, structural genomics, un 5e-07
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 3e-11
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 8e-05
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 7e-11
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 7e-08
1vr9_A213 CBS domain protein/ACT domain protein; structural 1e-10
1vr9_A213 CBS domain protein/ACT domain protein; structural 3e-07
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 1e-10
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 8e-09
2o16_A160 Acetoin utilization protein ACUB, putative; struct 3e-10
2o16_A160 Acetoin utilization protein ACUB, putative; struct 7e-09
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 5e-10
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 3e-09
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-09
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 2e-07
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 8e-08
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 4e-05
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 2e-04
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 1e-04
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 2e-04
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 3e-04
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 4e-04
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
 Score =  271 bits (695), Expect = 4e-89
 Identities = 172/312 (55%), Positives = 214/312 (68%), Gaps = 28/312 (8%)

Query: 68  DLEKDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSV 127
               +  + ++  F K H+CYDLIPTS+KLVVFDT L VKKAFFALV NG+RAAPLWDS 
Sbjct: 18  QETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSK 77

Query: 128 HQQYVGMLTITDFIKILQMYYTSSSITMEELEEHKLETN--------------------- 166
            Q +VGMLTITDFI IL  YY S+ + + ELEEHK+ET                      
Sbjct: 78  KQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASL 137

Query: 167 ------LIDYKIHRLPVID-EMGNVLYILTHKRILRFLFLYINDLPKPSFLNKTLRDLKI 219
                 LI  KIHRLPVID E GN LYILTHKRIL+FL L+I + PKP F++K+L +L+I
Sbjct: 138 FDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQI 197

Query: 220 GTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNL 279
           GTY N+  V   T +  AL  F++ RVSALP+ D +G +VDI++KFDVINLAAEKTY NL
Sbjct: 198 GTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNL 257

Query: 280 DVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDI 339
           DV++ +A +H++ +FEGV KC L ETL  ++ R+V AEVHRLVVVDE D V G++SLSDI
Sbjct: 258 DVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDI 317

Query: 340 LVYLVLKPSDDD 351
           L  LVL   +  
Sbjct: 318 LQALVLTGGEKK 329


>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query405
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 100.0
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 100.0
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 100.0
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.98
3ddj_A296 CBS domain-containing protein; structural genomics 99.98
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.96
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.88
3ddj_A296 CBS domain-containing protein; structural genomics 99.86
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.85
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.82
4esy_A170 CBS domain containing membrane protein; structural 99.82
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.82
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.81
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.81
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.8
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.8
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.8
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.8
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.79
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.78
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.78
4esy_A170 CBS domain containing membrane protein; structural 99.78
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.78
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.78
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.77
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.76
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.76
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.76
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.75
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.75
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.75
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.75
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.75
3ocm_A173 Putative membrane protein; structural genomics, PS 99.75
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.75
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.75
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.74
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.74
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.74
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.74
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.74
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.74
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.74
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.73
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.73
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.73
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.73
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.72
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.71
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.71
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.71
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.7
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.7
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.7
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.69
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.69
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.69
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.69
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.67
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.67
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.66
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.66
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.66
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.66
3ocm_A173 Putative membrane protein; structural genomics, PS 99.65
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.65
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.64
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.64
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.64
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.64
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.63
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.63
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.63
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.62
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.62
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.62
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.62
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.61
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.61
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.61
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.6
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.6
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.6
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.59
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.59
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.59
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.58
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.58
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.58
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.57
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.56
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.56
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.56
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.55
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.55
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.54
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.53
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.53
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.53
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.49
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.48
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.47
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.43
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.39
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.39
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.37
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.36
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.34
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 99.33
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.31
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.31
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.3
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.3
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.29
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.21
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.15
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.14
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.09
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.08
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.08
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.05
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.97
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 98.92
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.88
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.79
3fio_A70 A cystathionine beta-synthase domain protein fused 98.77
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.75
3fio_A70 A cystathionine beta-synthase domain protein fused 98.6
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
Probab=100.00  E-value=1.6e-37  Score=299.06  Aligned_cols=273  Identities=35%  Similarity=0.642  Sum_probs=226.6

Q ss_pred             ccchhHHHHHHhhhcccccccCCCCCeEEEeCCccHHHHHHHHHHcCCceeeeEeCCCCeeeeEEeHHHHHHHHHHhhCC
Q psy744           71 KDGGNQIFVKFFKFHKCYDLIPTSAKLVVFDTQLLVKKAFFALVYNGIRAAPLWDSVHQQYVGMLTITDFIKILQMYYTS  150 (405)
Q Consensus        71 ~~~~~~~~~~~l~~~~~~d~~p~s~~vv~v~~~~~v~~A~~~m~~~~i~~~PV~d~~~~~~~GilT~~Dil~~l~~~~~~  150 (405)
                      ++...+.+.+||+.++|||+||.+.++++++.+.++.+|++.|.+++++++||||++.++++|++|..|++..+..++..
T Consensus        16 ~~~~~~~i~~~l~~~~~~d~m~~~~~~v~v~~~~sv~~a~~~m~~~~~~~~pV~d~~~~~lvGilt~~Dl~~~l~~~~~~   95 (323)
T 3t4n_C           16 QQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSN   95 (323)
T ss_dssp             HHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHHHHHHHTTCSCEEEEETTTTEEEEEECHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHhCchHhhCCCCCcEEEEcCCCcHHHHHHHHHHcCCceEEEEeCCCCeEEEEEEHHHHHHHHHHHHcC
Confidence            34457888899999999999999999999999999999999999999999999998767999999999999987654332


Q ss_pred             CCC----------CHHHHhh---------------c---cHHHHHHhcCCCEEEEEeCCCC-----EEEEEeHHHHHHHH
Q psy744          151 SSI----------TMEELEE---------------H---KLETNLIDYKIHRLPVIDEMGN-----VLYILTHKRILRFL  197 (405)
Q Consensus       151 ~~~----------~~~~l~~---------------~---~i~~~l~~~~i~~lpVvd~~~~-----vvgilt~~dIl~~l  197 (405)
                      +..          .+.++..               .   .+...|.+++++++||+|+++.     ++|++|.+|+++++
T Consensus        96 ~~~~~~l~~~~~~~v~~i~~~~~~~~~~~v~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~~~~~l~Givt~~di~~~l  175 (323)
T 3t4n_C           96 PDKFELVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETHREIVVSVLTQYRILKFV  175 (323)
T ss_dssp             GGGGGGGGGCBHHHHHHHHHHTTC----CCCBCTTSBHHHHHHHHHHHTCSEEEEEEECTTTCCEEEEEEEEHHHHHHHH
T ss_pred             cchhHHHHHHHHHHHHHHHHHhCCCCCCceEeCCCCcHHHHHHHHHhCCeeEEEEEecCCCCCccceEEEecHHHHHHHH
Confidence            210          0111110               0   1122789999999999997765     99999999999998


Q ss_pred             HHhhCCCCCccccccccccccccccCCeeEEcCCCCHHHHHHHHHhcCCCEEEEECCCCcEEEEEeHHHHHHHHHhcccc
Q psy744          198 FLYINDLPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYT  277 (405)
Q Consensus       198 ~~~~~~~~~~~~~~~~v~~i~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGivt~~Dl~~~~~~~~~~  277 (405)
                      ..+...   ..+...++++++.++.++++++.+++++.++++.|.+++++++||+|++|+++|+||.+|+++++..+.+.
T Consensus       176 ~~~~~~---~~~~~~~v~~~~~~m~~~~~~v~~~~~~~~~~~~m~~~~~~~~pVvd~~~~~~Giit~~dl~~~~~~~~~~  252 (323)
T 3t4n_C          176 ALNCRE---THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGIYN  252 (323)
T ss_dssp             HHHCGG---GGGCCSBGGGTTCSBCTTCCCBCTTSBHHHHHHHHHHHTCSEEEEECTTCBEEEEEETTHHHHHHHTTHHH
T ss_pred             HhcCCc---hhhhhCcHHHcCCCCCCCcEEECCCCcHHHHHHHHHHcCCCEEEEECCCCeEEEEEeHHHHHHHHhhchhh
Confidence            765432   33456689999554468899999999999999999999999999999999999999999999988766444


Q ss_pred             chhhhHHHhhhccccCccCceEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeHHHHHHHHHhC
Q psy744          278 NLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLK  346 (405)
Q Consensus       278 ~l~~~v~~~~~~~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGiIt~~DIl~~l~~~  346 (405)
                      .+..++.++|........++.+|++++++.++++.|.+++++++||+|++|+++|+||.+||++++..+
T Consensus       253 ~~~~~v~~~m~~~~~~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~Vvd~~~~l~Giit~~Dil~~l~~~  321 (323)
T 3t4n_C          253 DLSLSVGEALMRRSDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLG  321 (323)
T ss_dssp             HTTSBHHHHGGGSCTTCCCCEEECTTCBHHHHHHHHHHSCCCEEEEECTTSBEEEEEEHHHHHHHHHHC
T ss_pred             hccCCHHHHHhhccccCCCCEEECCCCCHHHHHHHHHHhCCCEEEEECCCCcEEEEEEHHHHHHHHHhc
Confidence            556678888653222223789999999999999999999999999999899999999999999999854



>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 405
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 1e-28
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 4e-23
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 1e-05
d2ooxe2153 d.37.1.1 (E:182-334) Uncharacterized protein C1556 8e-21
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 2e-17
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 1e-09
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 6e-12
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 2e-07
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 1e-10
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 2e-10
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 0.003
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 6e-10
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 1e-08
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 2e-08
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 0.003
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 6e-08
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 1e-07
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 2e-07
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 5e-07
d1pbja3120 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A 5e-07
d2riha1131 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 3e-06
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 3e-06
d1zfja4126 d.37.1.1 (A:95-220) Type II inosine monophosphate 4e-06
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 7e-06
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 0.003
d3ddja2135 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 2e-05
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 3e-05
d1yava3132 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac 3e-05
d2yvxa2144 d.37.1.1 (A:132-275) Magnesium transporter MgtE {T 6e-05
d2ouxa2127 d.37.1.1 (A:136-262) Magnesium transporter MgtE {E 2e-04
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 9e-04
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 0.002
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  107 bits (267), Expect = 1e-28
 Identities = 82/144 (56%), Positives = 108/144 (75%)

Query: 204 LPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFA 263
            PKP F++K+L +L+IGTY N+  V   T +  AL  F++ RVSALP+ D +G +VDI++
Sbjct: 1   FPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYS 60

Query: 264 KFDVINLAAEKTYTNLDVTLKEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVV 323
           KFDVINLAAEKTY NLDV++ +A +H++ +FEGV KC L ETL  ++ R+V AEVHRLVV
Sbjct: 61  KFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVV 120

Query: 324 VDEDDHVLGVLSLSDILVYLVLKP 347
           VDE D V G++SLSDIL  LVL  
Sbjct: 121 VDEHDVVKGIVSLSDILQALVLTG 144


>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query405
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.89
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.88
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.88
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.87
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.87
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.83
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.82
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.82
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.82
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.81
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.81
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.81
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.8
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.8
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.79
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.79
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.79
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.79
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.78
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.77
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.76
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.76
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.76
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.75
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.75
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.75
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.74
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.74
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.73
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.73
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.73
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.73
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.73
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.71
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.7
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.68
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.68
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.68
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.68
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.66
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.66
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.66
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.65
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.64
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.64
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.64
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.63
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.63
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.63
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.62
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.57
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.57
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.89  E-value=4.3e-23  Score=173.19  Aligned_cols=144  Identities=57%  Similarity=0.906  Sum_probs=132.0

Q ss_pred             CCCccccccccccccccccCCeeEEcCCCCHHHHHHHHHhcCCCEEEEECCCCcEEEEEeHHHHHHHHHhccccchhhhH
Q psy744          204 LPKPSFLNKTLRDLKIGTYENVETVAEETSIIHALRKFLERRVSALPMTDSEGHLVDIFAKFDVINLAAEKTYTNLDVTL  283 (405)
Q Consensus       204 ~~~~~~~~~~v~~i~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGivt~~Dl~~~~~~~~~~~l~~~v  283 (405)
                      ++.++++.+++++++++++++++++.+++++.+|++.|.+++++++||+|++|+++|++|..|+++.+........+.++
T Consensus         1 ~p~~~f~~~~l~~l~i~~~~~v~~v~~~~tv~eal~~m~~~~~~~lpVvd~~~~~~Gvit~~di~~~l~~~~~~~~~~~v   80 (145)
T d2v8qe1           1 FPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSV   80 (145)
T ss_dssp             SSCCGGGGSBHHHHTCSBCSSCCCEETTCBHHHHHHHHHHHCCSEEEEECTTSBEEEEEEGGGTGGGGGSSCCCCCSSBH
T ss_pred             CCchHHhhCCHHHHcCCCCCCceEEcCcCcHHHHHHHHHHcCCCcccccccCCceEEEEEcchhhhhhhcccccchhhhh
Confidence            36688899999999988788999999999999999999999999999999999999999999999888776656667778


Q ss_pred             HHhhhccccCccCceEecCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEEEeHHHHHHHHHhCC
Q psy744          284 KEANEHKTDWFEGVEKCLLDETLFTVMERIVRAEVHRLVVVDEDDHVLGVLSLSDILVYLVLKP  347 (405)
Q Consensus       284 ~~~~~~~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGiIt~~DIl~~l~~~~  347 (405)
                      .+.+.....|..++.++.+++++.+++++|.+++++++||+|++|+++|+||.+||+++++..+
T Consensus        81 ~~~~~~~~~~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~Vvd~~g~l~GiVt~~dii~~lv~~~  144 (145)
T d2v8qe1          81 TKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTG  144 (145)
T ss_dssp             HHHGGGCCSCCCSCCEECTTSBHHHHHHHHHHHTCSEEEEECTTSBEEEEEEHHHHHHHHHSSC
T ss_pred             hhccchhhhccCCCeEECCCCcHHHHHHHHHHcCceEEEEEccCCEEEEEEEHHHHHHHHHhcC
Confidence            8887777778889999999999999999999999999999999999999999999999998654



>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure