Diaphorina citri psyllid: psy7467

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----

MERSLHGSCKRIFFKTSGGSAEVCGCWNVPRLIVDSLIRQYWAVNLKMEFTLEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDKNVFSMFKETVSNVMNTTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQVGGNMVFLYLWVFIILMSLFLMTIYPEFIAPLFDKYTPLPDGELKSRIEQLSASVKFPLKKLYVVEGSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLNADKKDKSGDSEPLISTEGANKKGCDTEEVLAVLAH

ccccccccccHHHHHcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHcccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEcc

********CKRIFFKTSGGSAEVCGCWNVPRLIVDSLIRQYWAVNLKMEFTLEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDKNVFSMFKETVSNVMNTTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQVGGNMVFLYLWVFIILMSLFLMTIYPEFIAPLFDKYTPLPDGELKSRIEQLSASVKFPLKKLYVVEGSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLN********************KKGCDTEEVLAVLAH

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CAAX prenyl protease 1 homolog	Proteolytically removes the C-terminal three residues of farnesylated proteins. Acts on lamin A/C.	confident	Q80W54
CAAX prenyl protease 1 homolog	Proteolytically removes the C-terminal three residues of farnesylated proteins.	confident	Q6EPN8
CAAX prenyl protease 1 homolog	Proteolytically removes the C-terminal three residues of farnesylated proteins. Acts on lamin A/C.	confident	O75844

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0030327 [BP]	prenylated protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0080120 [BP]	CAAX-box protein maturation	probable	GO:0044267, GO:0051604, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0004175 [MF]	endopeptidase activity	probable	GO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AW6, chain A
Confidence level:very confident
Coverage over the Query: 45-254,282-295
View the alignment between query and template
View the model in PyMOL