Diaphorina citri psyllid: psy7473

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
cEEEEEEccHHHHHHHHHHcccccccccccccEEEcccccccccHHHHHccccEEEEEcccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcc
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentQ66GT5
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentQ8WUK0
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentP0C089

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004439 [MF]phosphatidylinositol-4,5-bisphosphate 5-phosphatase activityprobableGO:0052866, GO:0016791, GO:0016787, GO:0042578, GO:0034593, GO:0003824, GO:0003674, GO:0016788, GO:0034595
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008962 [MF]phosphatidylglycerophosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0046855 [BP]inositol phosphate dephosphorylationprobableGO:0046434, GO:0016311, GO:0046174, GO:0019751, GO:0043647, GO:0044282, GO:0044712, GO:1901575, GO:0044262, GO:0071704, GO:0044281, GO:0046838, GO:0009987, GO:0046164, GO:0044710, GO:0008150, GO:0008152, GO:0009056, GO:0044238, GO:0005975, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0071545, GO:1901616, GO:1901615
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0032049 [BP]cardiolipin biosynthetic processprobableGO:0006655, GO:0006650, GO:0032048, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:0046471
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0006470 [BP]protein dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGO, chain A
Confidence level:very confident
Coverage over the Query: 25-135
View the alignment between query and template
View the model in PyMOL