Psyllid ID: psy7473

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
cEEEEEEccHHHHHHHHHHHccccccccccccEEEcccccccccHHHHHccccEEEEEcccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHccccccHHcccccEEEcccccccHHHHHHHccccEEEEEcccccccccccHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHcc
mfarvtfypSLFYNVFMEkvtsrrwydrideniilgalpfkrLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQlstrdifdtpdqdkleRGVDFIQRISktggtvyvhckagrtrsatLVGCYLMKC
mfarvtfypslfyNVFMEKVTSRRWYDRIDENIIlgalpfkrltnKLLEEnvkgvvsmNEDYELYFANGREEWNKVGVEFLQLStrdifdtpdqdklergVDFIQrisktggtvyvhckagrtrsatlvgcylmkc
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
**ARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLM**
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q86BN8200 Phosphatidylglycerophosph yes N/A 0.985 0.67 0.629 2e-48
Q8WUK0201 Phosphatidylglycerophosph yes N/A 0.985 0.666 0.503 3e-34
Q66GT5193 Phosphatidylglycerophosph yes N/A 0.985 0.694 0.510 6e-34
P0C089193 Phosphatidylglycerophosph yes N/A 0.985 0.694 0.510 1e-33
Q9ZQP1 337 Putative dual specificity yes N/A 0.963 0.388 0.425 3e-24
Q00684 551 Tyrosine-protein phosphat yes N/A 0.661 0.163 0.333 4e-06
Q75QN6 929 Dual specificity protein no N/A 0.411 0.060 0.410 1e-05
Q5FVI9211 Dual specificity protein no N/A 0.448 0.289 0.382 4e-05
Q9D700211 Dual specificity protein no N/A 0.448 0.289 0.382 4e-05
Q5R6H6211 Dual specificity protein no N/A 0.448 0.289 0.382 4e-05
>sp|Q86BN8|PTPM1_DROME Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster GN=Plip PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/151 (62%), Positives = 116/151 (76%), Gaps = 17/151 (11%)

Query: 1   MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLE-ENVKGVVSMN 59
           MFARV+FYP+L YNV MEK ++R WYDRIDE++ILGALPF+   N L+E EN+K VVSMN
Sbjct: 7   MFARVSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 60  EDYEL-YFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFI-------QRI---- 107
           EDYEL  F+N  E+W K+G+EFLQL+T DIF++P+Q+KL RGV+FI       QRI    
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 108 ----SKTGGTVYVHCKAGRTRSATLVGCYLM 134
                +  G+VYVHCKAGRTRSATLVGCYLM
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLM 157
Protein phosphatase that may mediate dephosphorylation of mitochondrial proteins (By similarity). Does not dephosphorylate Akt.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q8WUK0|PTPM1_HUMAN Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Homo sapiens GN=PTPMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q66GT5|PTPM1_MOUSE Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Mus musculus GN=Ptpmt1 PE=1 SV=1 Back     alignment and function description
>sp|P0C089|PTPM1_RAT Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Rattus norvegicus GN=Ptpmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQP1|DSP8_ARATH Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana GN=DSP8 PE=2 SV=2 Back     alignment and function description
>sp|Q00684|CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC14 PE=1 SV=2 Back     alignment and function description
>sp|Q75QN6|DPHS1_ARATH Dual specificity protein phosphatase PHS1 OS=Arabidopsis thaliana GN=PHS1 PE=1 SV=1 Back     alignment and function description
>sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 Back     alignment and function description
>sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 Back     alignment and function description
>sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
242019130178 conserved hypothetical protein [Pediculu 0.992 0.758 0.737 2e-54
346470443197 hypothetical protein [Amblyomma maculatu 0.992 0.685 0.722 5e-52
345495796196 PREDICTED: protein-tyrosine phosphatase 0.985 0.683 0.694 3e-50
328717172187 PREDICTED: protein-tyrosine phosphatase 0.985 0.716 0.698 7e-50
91086207185 PREDICTED: similar to dual-specificity p 0.992 0.729 0.680 5e-49
442756131195 Putative dual specificity phosphatase [I 0.992 0.692 0.693 2e-48
241680574198 dual specificity phosphatase, putative [ 0.992 0.681 0.693 2e-48
357613320189 hypothetical protein KGM_22039 [Danaus p 0.985 0.708 0.668 3e-48
157105458208 dual-specificity protein phosphatase, pu 0.985 0.644 0.629 8e-48
157126468208 dual-specificity protein phosphatase, pu 0.985 0.644 0.629 8e-48
>gi|242019130|ref|XP_002430018.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515080|gb|EEB17280.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/137 (73%), Positives = 120/137 (87%), Gaps = 2/137 (1%)

Query: 1   MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLL-EENVKGVVSMN 59
           MFARVTFYPSL YN+FME+ T RRWYDRIDE +ILGALPF+++TN+LL +EN+KGVVSMN
Sbjct: 1   MFARVTFYPSLLYNIFMERFTDRRWYDRIDETVILGALPFQKMTNQLLNDENIKGVVSMN 60

Query: 60  EDYEL-YFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHC 118
           E+YEL +F+N  +EWNK GVEFLQLST DIF+TP Q+KL +GV+FI +  K  G+VYVHC
Sbjct: 61  ENYELLFFSNSEKEWNKYGVEFLQLSTTDIFETPCQEKLLKGVNFINKYKKLNGSVYVHC 120

Query: 119 KAGRTRSATLVGCYLMK 135
           KAGRTRSATLVGCYLMK
Sbjct: 121 KAGRTRSATLVGCYLMK 137

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|346470443|gb|AEO35066.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|345495796|ref|XP_001606959.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328717172|ref|XP_001950488.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91086207|ref|XP_971869.1| PREDICTED: similar to dual-specificity protein phosphatase, putative [Tribolium castaneum] Back     alignment and taxonomy information
>gi|442756131|gb|JAA70225.1| Putative dual specificity phosphatase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|241680574|ref|XP_002412690.1| dual specificity phosphatase, putative [Ixodes scapularis] gi|215506492|gb|EEC15986.1| dual specificity phosphatase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|357613320|gb|EHJ68431.1| hypothetical protein KGM_22039 [Danaus plexippus] Back     alignment and taxonomy information
>gi|157105458|ref|XP_001648877.1| dual-specificity protein phosphatase, putative [Aedes aegypti] gi|108869010|gb|EAT33235.1| AAEL014504-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157126468|ref|XP_001654636.1| dual-specificity protein phosphatase, putative [Aedes aegypti] gi|108873274|gb|EAT37499.1| AAEL010530-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
ZFIN|ZDB-GENE-070112-272183 ptpmt1 "protein tyrosine phosp 0.992 0.737 0.496 2.4e-35
FB|FBgn0039111200 Plip "PTEN-like phosphatase" [ 0.779 0.53 0.648 1.1e-34
UNIPROTKB|J9NTP3275 PTPMT1 "Uncharacterized protei 0.977 0.483 0.507 3.7e-32
UNIPROTKB|Q8WUK0201 PTPMT1 "Phosphatidylglyceropho 0.977 0.661 0.507 3.7e-32
MGI|MGI:1913711193 Ptpmt1 "protein tyrosine phosp 0.977 0.689 0.514 1.3e-31
UNIPROTKB|F1SIF5201 PTPMT1 "Uncharacterized protei 0.977 0.661 0.492 1.6e-31
RGD|1589783193 Ptpmt1 "protein tyrosine phosp 0.977 0.689 0.514 1.6e-31
UNIPROTKB|Q2NKZ7270 PTPMT1 "Uncharacterized protei 0.977 0.492 0.5 2e-31
WB|WBGene00009207189 F28C6.8 [Caenorhabditis elegan 0.992 0.714 0.475 3.4e-29
UNIPROTKB|I2HA91189 F28C6.8 "Protein F28C6.8, isof 0.992 0.714 0.475 3.4e-29
ZFIN|ZDB-GENE-070112-272 ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 2.4e-35, P = 2.4e-35
 Identities = 68/137 (49%), Positives = 100/137 (72%)

Query:     1 MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLE-ENVKGVVSMN 59
             + AR+ FYP+L YNV MEK++ R+W++R+D  +ILGALPF+ +T +L++ E V+GV++MN
Sbjct:     4 VLARILFYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVITMN 63

Query:    60 EDYEL-YFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHC 118
             E+YE  YF N  EEW  VGVE ++L T D+   P  + + +GVDF  R  + G +VY+HC
Sbjct:    64 EEYETKYFCNSAEEWQSVGVEQIRLDTVDLTGVPSLEHIHKGVDFALRHREQGSSVYIHC 123

Query:   119 KAGRTRSATLVGCYLMK 135
             KAGR+RSAT+   YL++
Sbjct:   124 KAGRSRSATIAAAYLIR 140
GO:0016791 "phosphatase activity" evidence=IEA
GO:0006470 "protein dephosphorylation" evidence=IEA;IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IEA;IBA
GO:0016311 "dephosphorylation" evidence=IEA
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IBA
GO:0004439 "phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity" evidence=IBA
GO:0046855 "inositol phosphate dephosphorylation" evidence=IBA
GO:0016787 "hydrolase activity" evidence=IEA
FB|FBgn0039111 Plip "PTEN-like phosphatase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTP3 PTPMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUK0 PTPMT1 "Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIF5 PTPMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1589783 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2NKZ7 PTPMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q66GT5PTPM1_MOUSE3, ., 1, ., 3, ., 4, 80.51070.98520.6943yesN/A
Q86BN8PTPM1_DROME3, ., 1, ., 3, ., 4, 80.62910.98520.67yesN/A
P0C089PTPM1_RAT3, ., 1, ., 3, ., 4, 80.51070.98520.6943yesN/A
Q8WUK0PTPM1_HUMAN3, ., 1, ., 3, ., 4, 80.50350.98520.6666yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.914
3rd Layer3.1.30.921
3rd Layer3.1.3.480.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 6e-15
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 2e-14
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 1e-13
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 3e-10
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 6e-04
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
 Score = 66.2 bits (162), Expect = 6e-15
 Identities = 30/108 (27%), Positives = 47/108 (43%), Gaps = 8/108 (7%)

Query: 28  RIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRD 87
            I  ++ LG+  +    N  L + +         + +   N    +N     +L +   D
Sbjct: 3   EILPHLYLGS--YSDALNLALLKKL------GITHVINVTNEVPNYNGSDFTYLGVPIDD 54

Query: 88  IFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK 135
             +T         V+FI+     GG V VHC+AG +RSATL+  YLMK
Sbjct: 55  NTETKISPYFPEAVEFIEDAESKGGKVLVHCQAGVSRSATLIIAYLMK 102

Length = 138
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PRK12361 547 hypothetical protein; Provisional 99.97
KOG1719|consensus183 99.97
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.96
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.95
KOG1717|consensus343 99.94
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.94
KOG1718|consensus198 99.93
KOG1716|consensus 285 99.91
PTZ00242166 protein tyrosine phosphatase; Provisional 99.91
PTZ00393241 protein tyrosine phosphatase; Provisional 99.87
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.87
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.83
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.79
KOG1720|consensus225 99.79
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.79
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.75
PLN02727 986 NAD kinase 99.72
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 99.59
COG3453130 Uncharacterized protein conserved in bacteria [Fun 99.57
KOG1572|consensus249 99.48
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.38
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.38
KOG2836|consensus173 99.36
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 99.26
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.1
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.02
KOG2283|consensus 434 98.98
PHA02740298 protein tyrosine phosphatase; Provisional 98.98
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.97
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.95
PHA02738320 hypothetical protein; Provisional 98.93
PHA02742303 protein tyrosine phosphatase; Provisional 98.93
PHA02747312 protein tyrosine phosphatase; Provisional 98.93
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.89
PHA02746323 protein tyrosine phosphatase; Provisional 98.86
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.77
KOG0792|consensus1144 98.65
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.65
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.48
KOG0791|consensus374 98.37
KOG2386|consensus 393 98.32
KOG0790|consensus 600 98.25
KOG0789|consensus415 98.06
KOG4228|consensus 1087 97.83
KOG0793|consensus1004 97.63
KOG4228|consensus1087 96.61
PLN02160136 thiosulfate sulfurtransferase 96.59
KOG4471|consensus 717 96.42
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 96.38
PRK01415247 hypothetical protein; Validated 96.19
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 95.72
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 95.67
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 95.32
KOG1089|consensus 573 95.06
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 94.89
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 94.53
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 94.18
PRK05320257 rhodanese superfamily protein; Provisional 94.09
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 93.88
KOG1530|consensus136 93.87
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 92.6
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 92.57
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 92.21
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 91.74
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 91.09
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 90.95
COG1054 308 Predicted sulfurtransferase [General function pred 90.32
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 89.97
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 89.1
PRK10886 196 DnaA initiator-associating protein DiaA; Provision 88.96
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 88.95
PF04343122 DUF488: Protein of unknown function, DUF488; Inter 88.94
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 88.94
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 88.82
COG1660286 Predicted P-loop-containing kinase [General functi 88.71
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 87.79
COG0279 176 GmhA Phosphoheptose isomerase [Carbohydrate transp 87.4
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 87.15
PRK13938 196 phosphoheptose isomerase; Provisional 86.83
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 86.36
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 86.33
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 86.26
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 86.22
PRK05600370 thiamine biosynthesis protein ThiF; Validated 86.02
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 85.86
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 84.92
PRK07411390 hypothetical protein; Validated 83.61
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 82.93
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 80.72
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.97  E-value=1e-30  Score=203.02  Aligned_cols=130  Identities=25%  Similarity=0.467  Sum_probs=113.1

Q ss_pred             Ccceeeecchh----HHHHHHHHhcCCCccccccCcEEEeCCCCcccHHHHHhcCCCEEEEcccCcccccccChhhhhhc
Q psy7473           1 MFARVTFYPSL----FYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKV   76 (136)
Q Consensus         1 ~~~~~~~~p~~----~~~~~~~~~~~~~~~~~i~~~l~~g~~~~~~~~~~l~~~gi~~Vi~l~~~~~~~~~~~~~~~~~~   76 (136)
                      ++|+|+|+||+    .++++..+..+.+++++|.|+||+|+.+.+.+.+.|++.||++|||++.+.+.    .+......
T Consensus        66 ~~~~~l~~P~l~~~~~~~~~~r~~~~~~~~~~I~~~l~lG~~~~a~d~~~L~~~gI~~Vldlt~E~~~----~~~~~~~~  141 (547)
T PRK12361         66 WYIRWVFIPFLLGTRLYNAWARKRDSVPAIQKIDENLYLGCRLFPADLEKLKSNKITAILDVTAEFDG----LDWSLTEE  141 (547)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcccCCCcceEEcCcEEECCCCCcccHHHHHHcCCCEEEEccccccc----cccccccc
Confidence            46899999999    55666666778899999999999999999999999999999999999976541    11122346


Q ss_pred             CCeEEEeeCCCCCCCchHHHHHHHHHHHHHHHHcCCeEEEEcCCCCChHHHHHHHHhhc
Q psy7473          77 GVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK  135 (136)
Q Consensus        77 ~i~~~~~p~~D~~~~~~~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~v~~ayLm~  135 (136)
                      +++|+++|+.|.. .|..+++++++++|++..++|++|||||.+|+|||+++++||||+
T Consensus       142 ~i~yl~iPi~D~~-~p~~~~l~~a~~~i~~~~~~~~~VlVHC~~G~sRSa~vv~ayLm~  199 (547)
T PRK12361        142 DIDYLNIPILDHS-VPTLAQLNQAINWIHRQVRANKSVVVHCALGRGRSVLVLAAYLLC  199 (547)
T ss_pred             CceEEEeecCCCC-CCcHHHHHHHHHHHHHHHHCCCeEEEECCCCCCcHHHHHHHHHHH
Confidence            7999999999986 678899999999999999999999999999999999999999995

>KOG1719|consensus Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1089|consensus Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>KOG1530|consensus Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 3e-29
3rgq_A156 Crystal Structure Of Ptpmt1 In Complex With Pi(5)p 4e-28
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 4e-06
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 4e-05
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 5e-05
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 5e-05
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 7e-05
4erc_A150 Structure Of Vhz Bound To Metavanadate Length = 150 1e-04
2img_A151 Crystal Structure Of Dual Specificity Protein Phosp 3e-04
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 5e-04
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 6e-04
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 7e-04
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure 
Iteration: 1

 Score =  123 bits (309), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 2/113 (1%)
Query: 25  WYDRIDENIILGALPFKRLTNKL-LEENVKGVVSMNEDYELYF-ANGREEWNKVGVEFLQ 82
           WY RID  ++LGALP K +T +L L+ENV+GV++MNE+YE  F  N  +EW K GVE L+
Sbjct: 1   WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60
Query: 83  LSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK 135
           LST D+   P    L +GV F  +    G  VYVHCKAGR+RSAT+V  YL++
Sbjct: 61  LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQ 113
>pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 Back     alignment and structure
>pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 1e-43
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 5e-27
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 3e-23
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 5e-22
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 9e-18
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 4e-16
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 5e-16
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 8e-16
2q05_A195 Late protein H1, dual specificity protein phosphat 1e-15
3cm3_A176 Late protein H1, dual specificity protein phosphat 1e-15
2hcm_A164 Dual specificity protein phosphatase; structural g 1e-15
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 2e-15
2g6z_A 211 Dual specificity protein phosphatase 5; alpha/beta 4e-15
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 4e-15
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 6e-15
3emu_A161 Leucine rich repeat and phosphatase domain contain 7e-15
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 1e-14
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 1e-14
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 1e-14
2hxp_A155 Dual specificity protein phosphatase 9; human phos 2e-14
2oud_A177 Dual specificity protein phosphatase 10; A central 2e-14
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 2e-14
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 2e-14
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 2e-14
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 3e-14
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 6e-14
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 2e-13
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 4e-13
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 5e-13
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 7e-13
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 4e-12
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 1e-11
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 6e-10
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 7e-06
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 2e-05
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 5e-05
1xri_A151 AT1G05000; structural genomics, protein structure 4e-04
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 5e-04
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 9e-04
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
 Score =  139 bits (352), Expect = 1e-43
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 2/113 (1%)

Query: 25  WYDRIDENIILGALPFKRLTNKLL-EENVKGVVSMNEDYEL-YFANGREEWNKVGVEFLQ 82
           WY RID  ++LGALP K +T +L+ +ENV+GV++MNE+YE  +  N  +EW K GVE L+
Sbjct: 1   WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60

Query: 83  LSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK 135
           LST D+   P    L +GV F  +    G  VYVHCKAGR+RSAT+V  YL++
Sbjct: 61  LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQ 113
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.97
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.97
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.96
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.96
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.96
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.96
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.96
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.96
2oud_A177 Dual specificity protein phosphatase 10; A central 99.96
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.96
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.96
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.96
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.96
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.96
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.95
2hcm_A164 Dual specificity protein phosphatase; structural g 99.95
2g6z_A 211 Dual specificity protein phosphatase 5; alpha/beta 99.95
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.95
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.95
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.94
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.93
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.93
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.93
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.93
2q05_A195 Late protein H1, dual specificity protein phosphat 99.92
1xri_A151 AT1G05000; structural genomics, protein structure 99.92
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.91
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.89
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.87
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.85
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.85
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.84
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.84
2f46_A156 Hypothetical protein; structural genomics, joint c 99.84
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.82
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.71
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.65
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.63
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.59
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.54
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.47
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.35
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.33
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.23
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.19
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.17
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.13
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.12
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.11
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.1
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.1
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.09
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.08
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.07
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.06
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.06
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.06
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.05
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.03
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.03
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.03
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.01
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.01
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.01
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.99
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.99
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.99
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 98.98
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.94
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 98.9
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 98.9
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.88
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.86
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.86
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 98.84
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 98.84
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.8
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 98.79
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.77
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.74
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.62
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.58
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.48
1vee_A134 Proline-rich protein family; hypothetical protein, 95.89
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 95.78
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 95.39
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 94.93
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 94.55
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 94.01
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 93.66
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 93.5
1tq1_A129 AT5G66040, senescence-associated family protein; C 91.91
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 91.17
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 90.83
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 90.52
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 90.45
2jtq_A85 Phage shock protein E; solution structure rhodanes 90.07
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 89.21
3foj_A100 Uncharacterized protein; protein SSP1007, structur 86.45
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 86.38
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 85.35
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 85.12
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 84.97
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 84.61
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 84.15
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 83.72
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 83.03
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 82.77
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 81.83
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 81.46
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 81.29
3trj_A 201 Phosphoheptose isomerase; lipopolysaccharide biosy 81.01
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
Probab=99.97  E-value=8.5e-31  Score=172.77  Aligned_cols=111  Identities=52%  Similarity=0.978  Sum_probs=98.3

Q ss_pred             ccccccCcEEEeCCCCcccHHHH-HhcCCCEEEEcccCccc-ccccChhhhhhcCCeEEEeeCCCCCCCchHHHHHHHHH
Q psy7473          25 WYDRIDENIILGALPFKRLTNKL-LEENVKGVVSMNEDYEL-YFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVD  102 (136)
Q Consensus        25 ~~~~i~~~l~~g~~~~~~~~~~l-~~~gi~~Vi~l~~~~~~-~~~~~~~~~~~~~i~~~~~p~~D~~~~~~~~~~~~~~~  102 (136)
                      |+++|.|+||+|+.+.+.+...+ +++||++|||++.+.+. ......+.+...|++|+++|+.|....+..+.+.++++
T Consensus         1 wf~~I~~~l~~g~~~~~~~~~~ll~~~gi~~Vi~l~~~~e~~~~~~~~~~~~~~gi~~~~~p~~d~~~~~~~~~~~~~~~   80 (157)
T 3rgo_A            1 WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQ   80 (157)
T ss_dssp             CEEECSSSEEEESCCCGGGHHHHHHHSCEEEEEEESCCTTTTTSSCCHHHHHHTTCEEEEECCCTTTSSCCHHHHHHHHH
T ss_pred             CcccccCCeEEecCcCccchHHHHHHcCCCEEEECccccccccccCCHHHHHHCCCeEEEecCCCCCCCChHHHHHHHHH
Confidence            89999999999999998877666 88999999999988764 22223556667899999999999876888999999999


Q ss_pred             HHHHHHHcCCeEEEEcCCCCChHHHHHHHHhhc
Q psy7473         103 FIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK  135 (136)
Q Consensus       103 ~i~~~~~~~~~VlVHC~~G~~RS~~v~~ayLm~  135 (136)
                      +|++..++|++|||||.+|+||||+++++|||+
T Consensus        81 ~i~~~~~~~~~vlVHC~~G~~Rsg~~~~a~l~~  113 (157)
T 3rgo_A           81 FALKYQALGQCVYVHCKAGRSRSATMVAAYLIQ  113 (157)
T ss_dssp             HHHHHHHTTCEEEEESSSSSSHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEECCCCCChHHHHHHHHHHH
Confidence            999999999999999999999999999999996
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 1e-13
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 5e-13
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 4e-12
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 2e-09
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 1e-08
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 7e-08
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 3e-07
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 5e-07
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 2e-06
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 9e-06
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.1 bits (150), Expect = 1e-13
 Identities = 29/113 (25%), Positives = 45/113 (39%), Gaps = 2/113 (1%)

Query: 26  YDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFAN-GREEWNKVGVEFLQLS 84
            + +   I +G     +   KL +  +  V++  E       N     +   G+ +L + 
Sbjct: 23  CNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIK 82

Query: 85  TRDIFDTPDQDKLERGVDFIQRISKTG-GTVYVHCKAGRTRSATLVGCYLMKC 136
             D  +       ER  DFI +      G V VHC+ G +RS TLV  YLM  
Sbjct: 83  ANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMR 135
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.97
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.97
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.97
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.91
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.9
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.9
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.85
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.81
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.75
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 99.45
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.38
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.97
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.83
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.81
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.77
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.77
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.75
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.72
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.69
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.69
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.68
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 98.68
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 96.51
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 96.03
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 94.41
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 92.49
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 92.31
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 92.13
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 91.68
d1x94a_ 191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T 86.1
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 84.64
d1em8a_147 DNA polymerase III chi subunit {Escherichia coli [ 83.83
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=99.97  E-value=1.1e-31  Score=173.67  Aligned_cols=106  Identities=21%  Similarity=0.199  Sum_probs=95.6

Q ss_pred             CccccccCcEEEeCCCCcccHHHHHhcCCCEEEEcccCcccccccChhhhhhcCCeEEEeeCCCCCCCchHHHHHHHHHH
Q psy7473          24 RWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDF  103 (136)
Q Consensus        24 ~~~~~i~~~l~~g~~~~~~~~~~l~~~gi~~Vi~l~~~~~~~~~~~~~~~~~~~i~~~~~p~~D~~~~~~~~~~~~~~~~  103 (136)
                      .+|++|.|+||+|+...+.+.+.|++.||++|||++.+.+.      ......++.|+++|+.|.+.++..+.+++++++
T Consensus         2 ~~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~------~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~   75 (144)
T d1mkpa_           2 SFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPN------LFENAGEFKYKQIPISDHWSQNLSQFFPEAISF   75 (144)
T ss_dssp             CCCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCC------EEEEETTEEEEECCCCCSTTCCSGGGHHHHHHH
T ss_pred             CCCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCc------cccCCCceEEEEEEEecCCCCCHHHHHHHHHHH
Confidence            36899999999999999999999999999999999876541      223456799999999999877888899999999


Q ss_pred             HHHHHHcCCeEEEEcCCCCChHHHHHHHHhhc
Q psy7473         104 IQRISKTGGTVYVHCKAGRTRSATLVGCYLMK  135 (136)
Q Consensus       104 i~~~~~~~~~VlVHC~~G~~RS~~v~~ayLm~  135 (136)
                      |+++.++|++|||||.+|+|||+++++||||+
T Consensus        76 i~~~~~~~~~VlVHC~~G~~RS~~vv~aYLm~  107 (144)
T d1mkpa_          76 IDEARGKNCGVLVHSLAGISRSVTVTVAYLMQ  107 (144)
T ss_dssp             HHHHHHTTCEEEEECSSCSHHHHHHHHHHHHH
T ss_pred             HHHhhhccceEEEEecccccchHHHHHHHHHH
Confidence            99999999999999999999999999999997
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure