Diaphorina citri psyllid: psy7475

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRLTNKEDRNNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKLEPVPTC
cEEEEEEcccHHHHHHHHccccccccccccccEEEccccccccHHHHHHccccEEEEEEcccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHccccEEEEEEcccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHccccccc
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRLTNKEDRNNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKLEPV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRLTNKEDRNNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKLEPVPTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentQ66GT5
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentQ8WUK0
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.confidentP0C089

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016311 [BP]dephosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004439 [MF]phosphatidylinositol-4,5-bisphosphate 5-phosphatase activityprobableGO:0052866, GO:0016791, GO:0016787, GO:0042578, GO:0034593, GO:0003824, GO:0003674, GO:0016788, GO:0034595

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGO, chain A
Confidence level:very confident
Coverage over the Query: 25-166
View the alignment between query and template
View the model in PyMOL
Template: 3RGO, chain A
Confidence level:very confident
Coverage over the Query: 178-294
View the alignment between query and template
View the model in PyMOL