Psyllid ID: psy7475
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| 242019130 | 178 | conserved hypothetical protein [Pediculu | 0.467 | 0.775 | 0.728 | 6e-54 | |
| 346470443 | 197 | hypothetical protein [Amblyomma maculatu | 0.457 | 0.685 | 0.722 | 2e-51 | |
| 345495796 | 196 | PREDICTED: protein-tyrosine phosphatase | 0.454 | 0.683 | 0.694 | 9e-50 | |
| 328717172 | 187 | PREDICTED: protein-tyrosine phosphatase | 0.501 | 0.791 | 0.647 | 2e-49 | |
| 91086207 | 185 | PREDICTED: similar to dual-specificity p | 0.457 | 0.729 | 0.680 | 2e-48 | |
| 442756131 | 195 | Putative dual specificity phosphatase [I | 0.457 | 0.692 | 0.693 | 7e-48 | |
| 241680574 | 198 | dual specificity phosphatase, putative [ | 0.457 | 0.681 | 0.693 | 9e-48 | |
| 357613320 | 189 | hypothetical protein KGM_22039 [Danaus p | 0.454 | 0.708 | 0.668 | 1e-47 | |
| 157105458 | 208 | dual-specificity protein phosphatase, pu | 0.454 | 0.644 | 0.629 | 2e-47 | |
| 157126468 | 208 | dual-specificity protein phosphatase, pu | 0.454 | 0.644 | 0.629 | 2e-47 |
| >gi|242019130|ref|XP_002430018.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515080|gb|EEB17280.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 217 bits (552), Expect = 6e-54, Method: Compositional matrix adjust.
Identities = 102/140 (72%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
Query: 1 MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLL-EENVKGVVSMN 59
MFARVTFYPSL YN+FME+ T RRWYDRIDE +ILGALPF+++TN+LL +EN+KGVVSMN
Sbjct: 1 MFARVTFYPSLLYNIFMERFTDRRWYDRIDETVILGALPFQKMTNQLLNDENIKGVVSMN 60
Query: 60 EDYEL-YFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHC 118
E+YEL +F+N +EWNK GVEFLQLST DIF+TP Q+KL +GV+FI + K G+VYVHC
Sbjct: 61 ENYELLFFSNSEKEWNKYGVEFLQLSTTDIFETPCQEKLLKGVNFINKYKKLNGSVYVHC 120
Query: 119 KAGRTRSATLVGCYLMKVTS 138
KAGRTRSATLVGCYLMK S
Sbjct: 121 KAGRTRSATLVGCYLMKEHS 140
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|346470443|gb|AEO35066.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|345495796|ref|XP_001606959.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328717172|ref|XP_001950488.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91086207|ref|XP_971869.1| PREDICTED: similar to dual-specificity protein phosphatase, putative [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|442756131|gb|JAA70225.1| Putative dual specificity phosphatase [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|241680574|ref|XP_002412690.1| dual specificity phosphatase, putative [Ixodes scapularis] gi|215506492|gb|EEC15986.1| dual specificity phosphatase, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|357613320|gb|EHJ68431.1| hypothetical protein KGM_22039 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157105458|ref|XP_001648877.1| dual-specificity protein phosphatase, putative [Aedes aegypti] gi|108869010|gb|EAT33235.1| AAEL014504-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157126468|ref|XP_001654636.1| dual-specificity protein phosphatase, putative [Aedes aegypti] gi|108873274|gb|EAT37499.1| AAEL010530-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| FB|FBgn0039111 | 200 | Plip "PTEN-like phosphatase" [ | 0.410 | 0.605 | 0.615 | 7e-38 | |
| ZFIN|ZDB-GENE-070112-272 | 183 | ptpmt1 "protein tyrosine phosp | 0.461 | 0.743 | 0.492 | 1.9e-35 | |
| UNIPROTKB|Q8WUK0 | 201 | PTPMT1 "Phosphatidylglyceropho | 0.464 | 0.681 | 0.5 | 8.5e-33 | |
| UNIPROTKB|J9NTP3 | 275 | PTPMT1 "Uncharacterized protei | 0.454 | 0.487 | 0.510 | 1.4e-32 | |
| MGI|MGI:1913711 | 193 | Ptpmt1 "protein tyrosine phosp | 0.454 | 0.694 | 0.517 | 4.7e-32 | |
| RGD|1589783 | 193 | Ptpmt1 "protein tyrosine phosp | 0.454 | 0.694 | 0.517 | 6e-32 | |
| UNIPROTKB|Q2NKZ7 | 270 | PTPMT1 "Uncharacterized protei | 0.454 | 0.496 | 0.503 | 7.7e-32 | |
| UNIPROTKB|F1SIF5 | 201 | PTPMT1 "Uncharacterized protei | 0.454 | 0.666 | 0.489 | 1.3e-31 | |
| WB|WBGene00009207 | 189 | F28C6.8 [Caenorhabditis elegan | 0.484 | 0.756 | 0.463 | 2.3e-30 | |
| UNIPROTKB|I2HA91 | 189 | F28C6.8 "Protein F28C6.8, isof | 0.484 | 0.756 | 0.463 | 2.3e-30 |
| FB|FBgn0039111 Plip "PTEN-like phosphatase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 406 (148.0 bits), Expect = 7.0e-38, P = 7.0e-38
Identities = 85/138 (61%), Positives = 104/138 (75%)
Query: 167 NVFMEKVTSRRWYDRIDENIILGALPFKRLTNKLLE-ENVKGVVSMNEDYELY-FANGRE 224
NV MEK ++R WYDRIDE++ILGALPF+ N L+E EN+K VVSMNEDYEL F+N E
Sbjct: 20 NVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTE 79
Query: 225 EWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFI-------QRIS--------KTGGTVYV 269
+W K+G+EFLQL+T DIF++P+Q+KL RGV+FI QRI + G+VYV
Sbjct: 80 KWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYV 139
Query: 270 HCKAGRTRSATLVGCYLM 287
HCKAGRTRSATLVGCYLM
Sbjct: 140 HCKAGRTRSATLVGCYLM 157
|
|
| ZFIN|ZDB-GENE-070112-272 ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WUK0 PTPMT1 "Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NTP3 PTPMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1589783 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2NKZ7 PTPMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SIF5 PTPMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 9e-14 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 9e-14 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 3e-13 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 3e-13 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 2e-12 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 2e-12 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 5e-09 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 5e-09 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Score = 66.9 bits (164), Expect = 9e-14
Identities = 30/108 (27%), Positives = 47/108 (43%), Gaps = 8/108 (7%)
Query: 28 RIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRD 87
I ++ LG+ + N L + + + + N +N +L + D
Sbjct: 3 EILPHLYLGS--YSDALNLALLKKL------GITHVINVTNEVPNYNGSDFTYLGVPIDD 54
Query: 88 IFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMK 135
+T V+FI+ GG V VHC+AG +RSATL+ YLMK
Sbjct: 55 NTETKISPYFPEAVEFIEDAESKGGKVLVHCQAGVSRSATLIIAYLMK 102
|
Length = 138 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| KOG1719|consensus | 183 | 99.97 | ||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.96 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.95 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.94 | |
| KOG1718|consensus | 198 | 99.94 | ||
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.93 | |
| KOG1717|consensus | 343 | 99.93 | ||
| KOG1716|consensus | 285 | 99.91 | ||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.9 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.88 | |
| KOG1719|consensus | 183 | 99.87 | ||
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.87 | |
| KOG1718|consensus | 198 | 99.86 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.85 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.85 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.84 | |
| KOG1717|consensus | 343 | 99.83 | ||
| PRK12361 | 547 | hypothetical protein; Provisional | 99.82 | |
| KOG1720|consensus | 225 | 99.81 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.79 | |
| KOG1716|consensus | 285 | 99.79 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.74 | |
| KOG1720|consensus | 225 | 99.74 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.72 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.72 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.71 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.63 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.62 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.59 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.59 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.55 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.53 | |
| KOG4228|consensus | 1087 | 99.51 | ||
| PLN02727 | 986 | NAD kinase | 99.49 | |
| KOG2836|consensus | 173 | 99.48 | ||
| PLN02727 | 986 | NAD kinase | 99.39 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.33 | |
| KOG2836|consensus | 173 | 99.32 | ||
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.3 | |
| KOG1572|consensus | 249 | 99.26 | ||
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.26 | |
| KOG1572|consensus | 249 | 99.17 | ||
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.14 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.14 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.1 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.07 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.04 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.04 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.01 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.01 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.99 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.94 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.92 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.91 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.87 | |
| KOG0792|consensus | 1144 | 98.84 | ||
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.84 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.83 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.81 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.72 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.72 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.72 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.67 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.66 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.64 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.59 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.59 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.57 | |
| KOG0792|consensus | 1144 | 98.56 | ||
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.55 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.55 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.44 | |
| KOG2283|consensus | 434 | 98.42 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.35 | |
| KOG2386|consensus | 393 | 98.3 | ||
| KOG0793|consensus | 1004 | 98.26 | ||
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.22 | |
| KOG2283|consensus | 434 | 98.21 | ||
| KOG0790|consensus | 600 | 98.17 | ||
| KOG0791|consensus | 374 | 98.15 | ||
| KOG0790|consensus | 600 | 98.14 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.13 | |
| KOG0791|consensus | 374 | 98.02 | ||
| KOG4228|consensus | 1087 | 97.93 | ||
| KOG0789|consensus | 415 | 97.82 | ||
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 97.72 | |
| KOG2386|consensus | 393 | 97.65 | ||
| KOG0789|consensus | 415 | 97.58 | ||
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 97.55 | |
| KOG0793|consensus | 1004 | 97.28 | ||
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 96.75 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 95.24 | |
| KOG4471|consensus | 717 | 94.94 | ||
| KOG4471|consensus | 717 | 94.32 | ||
| PLN02160 | 136 | thiosulfate sulfurtransferase | 94.24 | |
| PRK08057 | 248 | cobalt-precorrin-6x reductase; Reviewed | 94.14 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 93.83 | |
| PRK01415 | 247 | hypothetical protein; Validated | 93.6 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 92.75 | |
| PF02571 | 249 | CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: | 92.05 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 91.45 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 91.36 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 90.72 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 90.59 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 90.25 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 90.25 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 89.9 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 89.68 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 89.37 | |
| KOG1089|consensus | 573 | 89.28 | ||
| KOG1089|consensus | 573 | 89.08 | ||
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 88.94 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 88.63 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 88.48 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 88.36 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 87.35 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 86.2 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 85.75 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 84.68 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 84.46 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 83.75 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 83.48 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 82.97 | |
| PRK01415 | 247 | hypothetical protein; Validated | 82.13 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 82.08 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 82.07 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 81.74 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 80.03 |
| >KOG1719|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.9e-30 Score=195.01 Aligned_cols=157 Identities=46% Similarity=0.803 Sum_probs=143.4
Q ss_pred CcceecchhhHHHHHHHHHhhcCCCcccccCceEEcCCcCh-hhHHHHHHcCCcEEEEcccccccccccchhhhhhcCce
Q psy7475 1 MFARVTFYPSLFYNVFMEKVTSRRWYDRIDENIILGALPFK-RLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVE 79 (295)
Q Consensus 1 ~~~~~~~~p~~~~~~~~~~~~~~~~~~~i~~~ly~G~~~~~-~~~~~L~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~~ 79 (295)
|+||.+|+|+|.|||++.+-..++|+ ++.+.+.+|..|.. .+.+.+++.|+..|+.+.++.+.-.+ -..++..|++
T Consensus 1 ~~ar~~fyptllynvv~~k~s~~~wy-~~~~~v~~~~~~FrS~~~~~i~ke~v~gvv~~ne~yE~~a~--s~~wk~~giE 77 (183)
T KOG1719|consen 1 MGARVLFYPTLLYNVVREKASAFRWY-RIDEFVILGAMPFRSMDVPLIKKENVGGVVTLNEPYELLAP--SNLWKNYGIE 77 (183)
T ss_pred CCceeeecHHHHHHHHHHHHhhhcee-eecceEEEeecccccccchHHHhcCCCeEEEeCCchhhhhh--hHHHHhccce
Confidence 78999999999999999998888998 89999999998765 56788999999999999988775111 2378899999
Q ss_pred EEEeecCCCCCCchHHHHHHHHHHHHHHHHcCCeEEEEcCCCCcchHHHHHHHHHHhhccCCChHHHHHHHHhcCCcccC
Q psy7475 80 FLQLSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRL 159 (295)
Q Consensus 80 ~~~~~~~D~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~~~l~~~~~~~~~~~~a~~~~~~~rp~~~~ 159 (295)
++.+|..|..+.|..+.+.++++||++....|+.|+|||.+|++||+++++||||.. ++|++++|+..+++.||.+-.
T Consensus 78 ~L~i~T~D~~~~Ps~~~i~~aVeFi~k~asLGktvYVHCKAGRtRSaTvV~cYLmq~--~~wtpe~A~~~vr~iRp~VlL 155 (183)
T KOG1719|consen 78 FLVIPTRDYTGAPSLENIQKAVEFIHKNASLGKTVYVHCKAGRTRSATVVACYLMQH--KNWTPEAAVEHVRKIRPRVLL 155 (183)
T ss_pred eEEeccccccCCCCHHHHHHHHHHHHhccccCCeEEEEecCCCccchhhhhhhhhhh--cCCCHHHHHHHHHhcCcceee
Confidence 999999999999999999999999999999999999999999999999999999999 999999999999999998877
Q ss_pred CCc
Q psy7475 160 TNK 162 (295)
Q Consensus 160 ~~~ 162 (295)
.+.
T Consensus 156 ~~~ 158 (183)
T KOG1719|consen 156 RPA 158 (183)
T ss_pred cHH
Confidence 655
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK08057 cobalt-precorrin-6x reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 295 | ||||
| 3rgo_A | 157 | Crystal Structure Of Ptpmt1 Length = 157 | 3e-29 | ||
| 3rgo_A | 157 | Crystal Structure Of Ptpmt1 Length = 157 | 6e-29 | ||
| 3rgq_A | 156 | Crystal Structure Of Ptpmt1 In Complex With Pi(5)p | 5e-28 | ||
| 3rgq_A | 156 | Crystal Structure Of Ptpmt1 In Complex With Pi(5)p | 1e-27 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 9e-06 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 9e-06 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 5e-05 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 1e-04 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 1e-04 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 1e-04 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 1e-04 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 2e-04 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 2e-04 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 2e-04 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 2e-04 | ||
| 4erc_A | 150 | Structure Of Vhz Bound To Metavanadate Length = 150 | 3e-04 | ||
| 4erc_A | 150 | Structure Of Vhz Bound To Metavanadate Length = 150 | 4e-04 | ||
| 2img_A | 151 | Crystal Structure Of Dual Specificity Protein Phosp | 6e-04 |
| >pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 | Back alignment and structure |
|
| >pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 | Back alignment and structure |
| >pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 | Back alignment and structure |
| >pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 | Back alignment and structure |
| >pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 | Back alignment and structure |
| >pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 2e-41 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 2e-41 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 5e-25 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 5e-25 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 2e-21 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 3e-21 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 3e-20 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 3e-20 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 2e-16 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 5e-16 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 8e-15 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 9e-15 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 1e-14 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 1e-14 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 1e-14 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 1e-14 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 3e-14 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 3e-14 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 3e-14 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 3e-14 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 4e-14 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 5e-14 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 4e-14 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 5e-14 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 7e-14 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 9e-14 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 8e-14 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 1e-13 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 9e-14 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 1e-13 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 1e-13 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 4e-13 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 1e-13 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 3e-13 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 1e-13 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 3e-13 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 2e-13 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 2e-13 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 2e-13 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 4e-13 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 3e-13 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 4e-13 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 3e-13 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 3e-13 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 3e-13 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 4e-13 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 4e-13 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 4e-13 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 4e-13 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 6e-13 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 8e-13 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 1e-12 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 4e-12 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 4e-12 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 5e-12 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 1e-11 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 7e-12 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 8e-12 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 8e-12 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 9e-12 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 3e-11 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 1e-10 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 5e-11 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 5e-11 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 4e-09 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 1e-08 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 1e-05 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 2e-04 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 6e-04 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 6e-04 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 1e-04 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 1e-04 |
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
Score = 139 bits (353), Expect = 2e-41
Identities = 58/119 (48%), Positives = 78/119 (65%), Gaps = 4/119 (3%)
Query: 25 WYDRIDENIILGALPFKRLTNKLL-EENVKGVVSMNEDYEL-YFANGREEWNKVGVEFLQ 82
WY RID ++LGALP K +T +L+ +ENV+GV++MNE+YE + N +EW K GVE L+
Sbjct: 1 WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60
Query: 83 LSTRDIFDTPDQDKLERGVDFIQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRW 141
LST D+ P L +GV F + G VYVHCKAGR+RSAT+V YL++ W
Sbjct: 61 LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQ--VHNW 117
|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.96 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.96 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.96 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.96 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.96 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.96 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.95 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.95 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.95 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.95 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.95 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.95 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.95 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.95 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.95 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.95 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.95 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.94 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.94 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.93 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.93 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.92 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.92 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.92 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.92 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.91 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.91 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.91 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.91 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.9 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.9 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.9 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.9 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.9 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.9 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.89 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.89 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.89 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.89 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.88 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.88 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.88 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.88 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.88 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.88 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.87 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.87 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.86 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.85 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.85 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.85 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.84 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.84 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.83 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.83 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.82 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.82 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.82 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.81 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.8 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.8 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.8 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.79 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.79 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.79 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.79 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.78 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.77 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.74 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.74 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.73 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.72 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.71 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.7 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.69 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.63 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.6 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.49 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.47 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.44 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.38 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.34 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.3 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.3 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.22 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.21 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.21 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.21 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.21 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.19 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.19 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.19 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.18 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.15 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.15 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.14 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.14 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.13 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.13 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.12 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.12 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.12 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.11 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.1 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.1 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.09 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.09 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.08 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.06 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.06 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.06 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.05 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.04 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.02 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.02 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.01 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.99 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.99 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.96 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.95 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.93 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.92 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.92 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.91 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.91 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.91 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.9 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.9 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.88 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.87 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.87 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.87 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.86 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.85 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.84 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.84 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.83 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.83 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.83 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.82 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.82 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.82 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.81 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.81 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 98.8 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.8 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.79 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.79 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.78 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.77 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.76 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.72 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.72 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.67 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.63 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.6 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 95.98 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 95.38 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 94.55 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 93.4 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 93.05 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 91.96 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 91.77 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 91.74 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 91.22 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 90.16 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 89.78 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 89.22 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 89.11 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 88.55 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 87.84 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 87.21 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 85.31 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 85.08 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 84.91 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 82.61 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 81.51 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 81.08 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 80.94 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 80.24 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 80.13 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=99.96 E-value=8.1e-30 Score=203.54 Aligned_cols=138 Identities=16% Similarity=0.138 Sum_probs=120.8
Q ss_pred CCcccccCceEEcCCcChhhHHHHHHcCCcEEEEcccccccccccchhhhhhcCceEEEeecCCCCCCchHHHHHHHHHH
Q psy7475 24 RWYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDF 103 (295)
Q Consensus 24 ~~~~~i~~~ly~G~~~~~~~~~~L~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~ 103 (295)
..+++|.|+||+|+.+.+.+.+.|+++||++|||++.+.+ .....+++|+++|+.|.+..++...|.++++|
T Consensus 8 ~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~--------~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~f 79 (161)
T 3emu_A 8 LSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVP--------SLFKDQCDILRLDIVSEEGHQLYDSIPNAIKF 79 (161)
T ss_dssp GSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC---------------CTTSEEEEECCCCSSTTHHHHHHHHHHHH
T ss_pred CCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCc--------cccCCCCEEEEEeCcCCCCCcHHHHHHHHHHH
Confidence 3489999999999999999999999999999999998654 12245899999999999888888899999999
Q ss_pred HHHHHHcCCeEEEEcCCCCcchHHHHHHHHHHhhccCCChHHHHHHHHhcCCcccCCCcccchhHHHH
Q psy7475 104 IQRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRLTNKEDRNNVFME 171 (295)
Q Consensus 104 i~~~~~~~~~vlVHC~~G~~Rs~~~~~~~l~~~~~~~~~~~~a~~~~~~~rp~~~~~~~~~~~~~l~~ 171 (295)
|++.+.++++|||||.+|.|||+++++||||+. ++|++++|++.+++.||.+.|+.++..+...++
T Consensus 80 I~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~--~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e 145 (161)
T 3emu_A 80 IIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYY--QRLSFINAFNKVQGLYPLIDIESGFILQLKLFE 145 (161)
T ss_dssp HHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHH--TTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHH
T ss_pred HHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHH--hCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHH
Confidence 999999999999999999999999999999999 999999999999999999999988765544433
|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 295 | ||||
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 1e-12 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 3e-12 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 3e-12 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 9e-12 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 1e-11 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 3e-11 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 2e-08 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 2e-08 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-07 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-07 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 3e-07 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 5e-07 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 1e-06 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-06 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 3e-06 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 3e-06 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-05 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-05 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 3e-05 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 5e-05 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Score = 62.9 bits (152), Expect = 1e-12
Identities = 29/120 (24%), Positives = 45/120 (37%), Gaps = 2/120 (1%)
Query: 26 YDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFAN-GREEWNKVGVEFLQLS 84
+ + I +G + KL + + V++ E N + G+ +L +
Sbjct: 23 CNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIK 82
Query: 85 TRDIFDTPDQDKLERGVDFIQRISKTG-GTVYVHCKAGRTRSATLVGCYLMKVTSRRWYD 143
D + ER DFI + G V VHC+ G +RS TLV YLM
Sbjct: 83 ANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKS 142
|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.97 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.97 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.96 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.91 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.91 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.9 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.88 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.87 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.81 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.81 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.8 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.79 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.78 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.77 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.75 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.68 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.66 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.46 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.16 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 99.12 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.12 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.0 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.98 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.96 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.91 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.89 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.88 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.87 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.86 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.85 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.84 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.79 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.78 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.76 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.66 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.63 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.57 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.55 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.51 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.47 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.47 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.47 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.47 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.41 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 97.61 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 94.54 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 92.28 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 92.0 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 90.83 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 90.51 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 88.78 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 83.73 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 80.97 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 80.56 |
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=99.97 E-value=1e-30 Score=203.21 Aligned_cols=135 Identities=17% Similarity=0.082 Sum_probs=122.5
Q ss_pred CcccccCceEEcCCcChhhHHHHHHcCCcEEEEcccccccccccchhhhhhcCceEEEeecCCCCCCchHHHHHHHHHHH
Q psy7475 25 WYDRIDENIILGALPFKRLTNKLLEENVKGVVSMNEDYELYFANGREEWNKVGVEFLQLSTRDIFDTPDQDKLERGVDFI 104 (295)
Q Consensus 25 ~~~~i~~~ly~G~~~~~~~~~~L~~~gi~~Vv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~i 104 (295)
+|++|.|+||+|+..++.+.+.|+++||++|||++.+.+ .......+++|+++|+.|.+..++.+.|+++++||
T Consensus 3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~------~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i 76 (144)
T d1mkpa_ 3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLP------NLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFI 76 (144)
T ss_dssp CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCC------CEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHH
T ss_pred CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCC------ccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHH
Confidence 589999999999999999999999999999999988765 22244568999999999998888889999999999
Q ss_pred HHHHHcCCeEEEEcCCCCcchHHHHHHHHHHhhccCCChHHHHHHHHhcCCcccCCCcccchh
Q psy7475 105 QRISKTGGTVYVHCKAGRTRSATLVGCYLMKVTSRRWYDRIDENIILGALPFKRLTNKEDRNN 167 (295)
Q Consensus 105 ~~~~~~~~~vlVHC~~G~~Rs~~~~~~~l~~~~~~~~~~~~a~~~~~~~rp~~~~~~~~~~~~ 167 (295)
++..++|++|||||.+|.|||++++++|||.. .++++++|++.++++||.+.++.++..+.
T Consensus 77 ~~~~~~~~~VlVHC~~G~~RS~~vv~aYLm~~--~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL 137 (144)
T d1mkpa_ 77 DEARGKNCGVLVHSLAGISRSVTVTVAYLMQK--LNLSMNDAYDIVKMKKSNISPNFNFMGQL 137 (144)
T ss_dssp HHHHHTTCEEEEECSSCSHHHHHHHHHHHHHH--HTCCHHHHHHHHHHHCTTCCCCSTTHHHH
T ss_pred HHhhhccceEEEEecccccchHHHHHHHHHHH--hCCCHHHHHHHHHHHCCCCCCCHHHHHHH
Confidence 99999999999999999999999999999999 89999999999999999999887755433
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|