Diaphorina citri psyllid: psy7477


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
ALQIPTVSPYSTSSPSEKPVSASTLKDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKIPTLSPYSTSSPSEKPVSASTLKDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKVVIDQTSLEYVQGSVIEYHQELIRSAFQISNNPQVEQGNLTKGDHFISPSNITRIRPRLSYRISPGIDSVCFPN
cccccccccccccccccccccccccccEEEcHHHHHHHHHHccccccEEEEEEccccccCEEccEEccccccccEEEECccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEcccccccccccEEccccccccEEEEEccEEEEEccccHHHccccEEEEEccccccccEEccccccccccccccccccccccccccccccEEEEccccccccccc
*************************KDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKIPTLSPYS**************KDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKVVIDQTSLEYVQGSVIEYHQELIRSAFQISNNPQVEQGNLTKGDHFISPSNITRIRPRLSYRISPGIDSVCFP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALQIPTVSPYSTSSPSEKPVSASTLKDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKIPTLSPYSTSSPSEKPVSASTLKDLVIHDSCIKKLKEISTDGSFLRIIVEGGGCSGFQYKFELDTQVSDEDRVYEKSGCKVVIDQTSLEYVQGSVIEYHQELIRSAFQISNNPQVEQGNLTKGDHFISPSNITRIRPRLSYRISPGIDSVCFPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Iron-sulfur cluster assembly 2 homolog, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.confidentQ86U28
Iron-sulfur cluster assembly 2 homolog, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.confidentQ5R788
Iron-sulfur cluster assembly 2 homolog, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.confidentQ9DCB8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0008150 [BP]biological_processprobable
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R94, chain A
Confidence level:very confident
Coverage over the Query: 106-200
View the alignment between query and template
View the model in PyMOL
Template: 2APN, chain A
Confidence level:very confident
Coverage over the Query: 22-113
View the alignment between query and template
View the model in PyMOL