Diaphorina citri psyllid: psy7478


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
LQNSSTTQVSKYKRRKKKKEEEDEEGGGGEEEEEEEEKKKEEKKKEKKKKEEEKKKEGEKRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE
cccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEECcccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccc
****************************************************************TFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYL*K******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LQNSSTTQVSKYKRRKKKKEEEDEEGGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 5 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentP42749

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070936 [BP]protein K48-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0070979 [BP]protein K11-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0033503 [CC]HULC complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0043226, GO:0044424, GO:0044427, GO:0005694, GO:0031371, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z5D, chain A
Confidence level:very confident
Coverage over the Query: 59-180
View the alignment between query and template
View the model in PyMOL
Template: 4ADY, chain A
Confidence level:probable
Coverage over the Query: 53-57
View the alignment between query and template
View the model in PyMOL