Psyllid ID: psy7478

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
LQNSSTTQVSKYKRRKKKKEEEDEEGGGGEEEEEEEEKKKEEKKKEKKKKEEEKKKEGEKRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE
cccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccc
cccccccEEEcEccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEEEccccccccccEHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHcc
LQNSSTTQVSKYKRRKkkkeeedeeggggeeeeeEEEKKKEEKKKEKKKKEEEKKKEGEKRRTLTFirigkpalkprptrcvegegaptrtlsvqiplhrvheqgvppvvyppsiynhqstlysGTVCLnvinqewtplydlsniFETFlpqlltypnptdplngdaaamyldkpdkyke
lqnssttqvskykrrkkkkeeedeeggggeeeeeeeekkkeekkkekkkkeeekkkegekrrtltfirigkpalkprptrcvegegaPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAmyldkpdkyke
LQNSSTTQVSKYKRRkkkkeeedeeggggeeeeeeeekkkeekkkekkkkeeekkkegekRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE
****************************************************************TFIRIG*******************RTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPN**********************
*******************************************************************RIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYL*K******
************************************************************RRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE
******T****************************************************KRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPD*Y**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LQNSSTTQVSKYKRRKKKKEEEDEEGGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
P62257183 Ubiquitin-conjugating enz no N/A 0.316 0.311 0.789 7e-23
P62256183 Ubiquitin-conjugating enz no N/A 0.316 0.311 0.789 7e-23
Q32LN1183 Ubiquitin-conjugating enz yes N/A 0.316 0.311 0.789 7e-23
P42749185 Ubiquitin-conjugating enz yes N/A 0.455 0.443 0.506 3e-19
P42748187 Ubiquitin-conjugating enz no N/A 0.455 0.438 0.506 9e-19
P16577184 Ubiquitin-conjugating enz N/A N/A 0.472 0.461 0.470 5e-18
Q9P7R4184 Ubiquitin-conjugating enz yes N/A 0.305 0.298 0.654 1e-17
P42750183 Ubiquitin-conjugating enz no N/A 0.366 0.360 0.545 1e-16
P28263218 Ubiquitin-conjugating enz yes N/A 0.411 0.339 0.432 1e-11
Q54TI6230 NEDD8-conjugating enzyme no N/A 0.366 0.286 0.358 4e-07
>sp|P62257|UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus musculus GN=Ube2h PE=2 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 45/57 (78%), Positives = 52/57 (91%)

Query: 124 SGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE 180
           SGTVCL+VINQ WT LYDL+NIFE+FLPQLL YPNP DPLNGDAAAMYL +P++YK+
Sbjct: 83  SGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQ 139
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|P62256|UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens GN=UBE2H PE=1 SV=1 Back     alignment and function description
>sp|Q32LN1|UBE2H_BOVIN Ubiquitin-conjugating enzyme E2 H OS=Bos taurus GN=UBE2H PE=2 SV=1 Back     alignment and function description
>sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana GN=UBC5 PE=2 SV=2 Back     alignment and function description
>sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana GN=UBC4 PE=2 SV=2 Back     alignment and function description
>sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum aestivum GN=UBC4 PE=1 SV=1 Back     alignment and function description
>sp|Q9P7R4|UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc8 PE=3 SV=1 Back     alignment and function description
>sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana GN=UBC6 PE=2 SV=2 Back     alignment and function description
>sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC8 PE=1 SV=2 Back     alignment and function description
>sp|Q54TI6|UBC12_DICDI NEDD8-conjugating enzyme Ubc12 OS=Dictyostelium discoideum GN=ube2m PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
403182933 442 AAEL017518-PA [Aedes aegypti] 0.405 0.165 0.698 9e-24
340710962 303 PREDICTED: ubiquitin-conjugating enzyme 0.405 0.240 0.684 3e-23
380014652 303 PREDICTED: ubiquitin-conjugating enzyme 0.405 0.240 0.684 3e-23
328784887 304 PREDICTED: ubiquitin-conjugating enzyme 0.405 0.240 0.684 3e-23
383862601 300 PREDICTED: ubiquitin-conjugating enzyme 0.405 0.243 0.684 3e-23
157136732182 ubiquitin-conjugating enzyme h [Aedes ae 0.405 0.401 0.698 8e-23
307189493214 Ubiquitin-conjugating enzyme E2 H [Campo 0.405 0.341 0.684 1e-22
91095029181 PREDICTED: similar to ubiquitin-conjugat 0.405 0.403 0.684 1e-22
321472094186 hypothetical protein DAPPUDRAFT_302154 [ 0.405 0.392 0.684 1e-22
170058935182 ubiquitin-conjugating enzyme E2 H [Culex 0.405 0.401 0.698 1e-22
>gi|403182933|gb|EJY57730.1| AAEL017518-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 58/73 (79%)

Query: 107 PPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGD 166
           P + +   IY+      SGTVCL+VINQ WT LYDLSNIFE+FLPQLLTYPNP DPLNGD
Sbjct: 66  PSIGFMNKIYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNGD 125

Query: 167 AAAMYLDKPDKYK 179
           AAAMYL KP++YK
Sbjct: 126 AAAMYLHKPEEYK 138

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340710962|ref|XP_003394051.1| PREDICTED: ubiquitin-conjugating enzyme E2 H-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380014652|ref|XP_003691338.1| PREDICTED: ubiquitin-conjugating enzyme E2 H-like [Apis florea] Back     alignment and taxonomy information
>gi|328784887|ref|XP_395791.3| PREDICTED: ubiquitin-conjugating enzyme E2 H [Apis mellifera] Back     alignment and taxonomy information
>gi|383862601|ref|XP_003706772.1| PREDICTED: ubiquitin-conjugating enzyme E2 H-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157136732|ref|XP_001656897.1| ubiquitin-conjugating enzyme h [Aedes aegypti] gi|108869878|gb|EAT34103.1| AAEL013633-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307189493|gb|EFN73870.1| Ubiquitin-conjugating enzyme E2 H [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91095029|ref|XP_966439.1| PREDICTED: similar to ubiquitin-conjugating enzyme E2 H isoform 1 [Tribolium castaneum] gi|270014763|gb|EFA11211.1| hypothetical protein TcasGA2_TC005175 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321472094|gb|EFX83065.1| hypothetical protein DAPPUDRAFT_302154 [Daphnia pulex] Back     alignment and taxonomy information
>gi|170058935|ref|XP_001865141.1| ubiquitin-conjugating enzyme E2 H [Culex quinquefasciatus] gi|167877836|gb|EDS41219.1| ubiquitin-conjugating enzyme E2 H [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
UNIPROTKB|F1NRU8165 UBE2H "Uncharacterized protein 0.411 0.448 0.635 4.3e-22
UNIPROTKB|Q32LN1183 UBE2H "Ubiquitin-conjugating e 0.411 0.404 0.635 4.3e-22
UNIPROTKB|E2RJH3183 UBE2H "Uncharacterized protein 0.411 0.404 0.635 4.3e-22
UNIPROTKB|C9J8Q9149 UBE2H "Ubiquitin-conjugating e 0.411 0.496 0.635 4.3e-22
UNIPROTKB|P62256183 UBE2H "Ubiquitin-conjugating e 0.411 0.404 0.635 4.3e-22
MGI|MGI:104632183 Ube2h "ubiquitin-conjugating e 0.411 0.404 0.635 4.3e-22
ZFIN|ZDB-GENE-030616-67183 ube2h "ubiquitin-conjugating e 0.411 0.404 0.635 7e-22
DICTYBASE|DDB_G0280091185 DDB_G0280091 "ubiquitin--prote 0.477 0.464 0.546 1.5e-21
FB|FBgn0029996183 Ubc-E2H "Ubc-E2H" [Drosophila 0.4 0.393 0.652 1.9e-21
UNIPROTKB|F1SMR7172 UBE2H "Uncharacterized protein 0.405 0.424 0.621 1.7e-20
UNIPROTKB|F1NRU8 UBE2H "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 47/74 (63%), Positives = 58/74 (78%)

Query:   107 PPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGD 166
             P + +   I++      SGTVCL+VINQ WT LYDL+NIFE+FLPQLL YPNP DPLNGD
Sbjct:    48 PSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGD 107

Query:   167 AAAMYLDKPDKYKE 180
             AAAMYL +P++YK+
Sbjct:   108 AAAMYLHRPEEYKQ 121
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0070936 "protein K48-linked ubiquitination" evidence=IEA
GO:0070979 "protein K11-linked ubiquitination" evidence=IEA
UNIPROTKB|Q32LN1 UBE2H "Ubiquitin-conjugating enzyme E2 H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJH3 UBE2H "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9J8Q9 UBE2H "Ubiquitin-conjugating enzyme E2 H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62256 UBE2H "Ubiquitin-conjugating enzyme E2 H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:104632 Ube2h "ubiquitin-conjugating enzyme E2H" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-67 ube2h "ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280091 DDB_G0280091 "ubiquitin--protein ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0029996 Ubc-E2H "Ubc-E2H" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMR7 UBE2H "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42749UBC5_ARATH6, ., 3, ., 2, ., 1, 90.50600.45550.4432yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.19LOW CONFIDENCE prediction!
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 7e-17
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-15
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 6e-15
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 3e-12
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 3e-05
pfam00183 529 pfam00183, HSP90, Hsp90 protein 7e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.002
PRK13735942 PRK13735, PRK13735, conjugal transfer mating pair 0.002
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.002
pfam08229196 pfam08229, SHR3_chaperone, ER membrane protein SH3 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 0.004
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information 
 Score = 72.6 bits (179), Expect = 7e-17
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 17/97 (17%)

Query: 91  TLSVQIPLHRVHEQGVPPVV------YPPSIYNHQSTLYSGTVCLNVINQE-WTPLYDLS 143
            L ++ P     +   PP V      Y P++        SG +CL+++  E W+P   + 
Sbjct: 47  KLDIEFPEDYPFK---PPKVKFTTKIYHPNVDP------SGEICLDILKDENWSPALTIE 97

Query: 144 NIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE 180
            +    +  LL+ PNP DPLN +AA +Y    +++++
Sbjct: 98  QVL-LSIQSLLSEPNPEDPLNAEAAKLYRKNREEFEK 133

Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|184287 PRK13735, PRK13735, conjugal transfer mating pair stabilization protein TraG; Provisional Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0417|consensus148 100.0
KOG0419|consensus152 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0425|consensus171 100.0
KOG0421|consensus175 99.98
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.97
KOG0418|consensus200 99.97
KOG0424|consensus158 99.97
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.97
KOG0416|consensus189 99.97
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.97
KOG0426|consensus165 99.96
KOG0422|consensus153 99.95
KOG0420|consensus184 99.95
KOG0423|consensus223 99.88
KOG0427|consensus161 99.84
KOG0429|consensus258 99.83
KOG0894|consensus 244 99.72
KOG0428|consensus 314 99.58
KOG0896|consensus138 99.26
KOG0895|consensus 1101 99.18
KOG0895|consensus 1101 98.89
KOG0897|consensus122 98.32
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.12
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 97.62
KOG2391|consensus 365 95.84
PF14457162 Prok-E2_A: Prokaryotic E2 family A 93.11
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 92.38
PF14462122 Prok-E2_E: Prokaryotic E2 family E 89.17
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 87.25
smart00591107 RWD domain in RING finger and WD repeat containing 85.89
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-38  Score=251.97  Aligned_cols=108  Identities=29%  Similarity=0.575  Sum_probs=105.6

Q ss_pred             CccceEEEEecCCCCCCCCCCCCCCCCCCeeEEEEEecCCCCCCCCCCcEeeCCCcccCCCCCCCCeEEeccCCCCCCCC
Q psy7478          60 KRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPL  139 (180)
Q Consensus        60 nl~~W~~~I~Gp~~~~~~p~tpy~ggg~~~f~~~I~fp~~YP~~~~pP~V~F~t~IfHPnV~~~~G~vCl~~l~e~WsP~  139 (180)
                      |+++|+++|.||+      +|+|+||   +|+++|.||.+||+  +||+|+|.|+||||||+ .+|.|||++|.+.|+|+
T Consensus        34 ~l~~w~~~i~GP~------dtpYegg---~f~~~l~fP~~YP~--~PPkv~F~t~i~HPNV~-~~G~vCLdIL~~~WsP~  101 (153)
T COG5078          34 NLFHWEATITGPP------DTPYEGG---IFKLTLEFPEDYPF--KPPKVRFTTKIFHPNVD-PSGNVCLDILKDRWSPV  101 (153)
T ss_pred             cceeEEEEEECCC------CCCcCCC---EEEEEEECCCCCCC--CCCeeeeccCCcCCCcC-CCCCChhHHHhCCCCcc
Confidence            9999999999999      9999999   99999999999999  99999999999999999 79999999999999999


Q ss_pred             CChHHHHHHHHHHHhcCCCCCCCccHHHHHHHhhCHHhHhC
Q psy7478         140 YDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE  180 (180)
Q Consensus       140 ~tl~~iL~~Ii~~ll~~P~~~~p~N~eaA~ly~~d~~~F~k  180 (180)
                      ++|.+||++| +.||.+||.++|+|.+||++|++|++.|.+
T Consensus       102 ~~l~sILlsl-~slL~~PN~~~Pln~daa~~~~~d~~~y~~  141 (153)
T COG5078         102 YTLETILLSL-QSLLLSPNPDSPLNTEAATLYREDKEEYEK  141 (153)
T ss_pred             ccHHHHHHHH-HHHHcCCCCCCCCChHHHHHHHhCHHHHHH
Confidence            9999999999 699999999999999999999999999964

>KOG0417|consensus Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0897|consensus Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2z5d_A179 Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 4e-23
2onu_A152 Plasmodium Falciparum Ubiquitin Conjugating Enzyme 4e-18
1yf9_A171 Structural Analysis Of Leishmania Major Ubiquitin C 2e-15
3o2u_A190 S. Cerevisiae Ubc12 Length = 190 4e-08
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 8e-08
1jas_A152 Hsubc2b Length = 152 1e-07
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 1e-06
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 1e-06
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-06
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 1e-05
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 3e-05
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-05
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 3e-05
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 3e-05
1y8x_A160 Structural Basis For Recruitment Of Ubc12 By An E2- 4e-05
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 5e-05
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 5e-05
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 5e-05
1x23_A155 Crystal Structure Of Ubch5c Length = 155 6e-05
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-04
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 1e-04
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-04
2nvu_C180 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 1e-04
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-04
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 2e-04
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 2e-04
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 2e-04
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 2e-04
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 2e-04
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 2e-04
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 2e-04
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 2e-04
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 2e-04
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 2e-04
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 2e-04
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 2e-04
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 3e-04
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-04
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-04
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 4e-04
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 5e-04
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 8e-04
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 8e-04
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 9e-04
>pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (258), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/74 (63%), Positives = 58/74 (78%)
Query: 107 PPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGD 166
           P + +   I++      SGTVCL+VINQ WT LYDL+NIFE+FLPQLL YPNP DPLNGD
Sbjct: 85  PSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGD 144
Query: 167 AAAMYLDKPDKYKE 180
           AAAMYL +P++YK+
Sbjct: 145 AAAMYLHRPEEYKQ 158
>pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 Back     alignment and structure
>pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 Back     alignment and structure
>pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 7e-22
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 2e-21
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 2e-21
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 6e-14
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 8e-14
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 1e-13
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 3e-13
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 4e-13
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 4e-13
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 5e-13
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 5e-13
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 7e-13
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 7e-13
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 1e-12
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-12
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 1e-12
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 1e-12
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 3e-12
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 3e-12
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 3e-12
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 6e-12
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 7e-12
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 8e-12
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 2e-11
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 3e-11
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 6e-11
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 8e-11
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 1e-10
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 1e-10
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 1e-10
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 1e-10
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 2e-10
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 7e-10
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 2e-09
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 2e-09
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 3e-09
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 1e-08
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 4e-08
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-07
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 3e-07
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 2e-06
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 3e-06
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 2e-05
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 3e-05
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 5e-05
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 2e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 3e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 4e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 6e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 6e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 7e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 7e-04
2zjr_S237 50S ribosomal protein L25; ribosome, large ribosom 7e-04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 4e-04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 8e-04
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
 Score = 85.4 bits (212), Expect = 7e-22
 Identities = 38/57 (66%), Positives = 47/57 (82%)

Query: 124 SGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE 180
           SG+VCL+VINQ WTPLY L N+FE FLPQLLTYPNP+DPLN DAA++ +   + Y+E
Sbjct: 80  SGSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLNSDAASLLMKDKNIYEE 136
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>2zjr_S 50S ribosomal protein L25; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.53.1.1 PDB: 1njm_T* 1nwx_T* 1njp_T* 1xbp_T* 2zjp_S* 2zjq_S 1nwy_T 3cf5_S* 3dll_S* 3pio_S* 3pip_S* 1nkw_T 1sm1_T* 1yl3_V 2b66_Z 2b9n_Z 2b9p_Z 1pnu_T 1pny_T 1vor_W ... Length = 237 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.97
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.97
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.97
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.97
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.96
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.96
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.96
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.96
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.95
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.92
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.92
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.72
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.62
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.24
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.18
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 82.9
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 82.36
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 81.81
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 81.55
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=4.1e-36  Score=235.38  Aligned_cols=111  Identities=24%  Similarity=0.505  Sum_probs=107.1

Q ss_pred             cCCCccceEEEEecCCCCCCCCCCCCCCCCCCeeEEEEEecCCCCCCCCCCcEeeCCCcccCCCCCCCCeEEeccCCCCC
Q psy7478          57 EGEKRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEW  136 (180)
Q Consensus        57 eg~nl~~W~~~I~Gp~~~~~~p~tpy~ggg~~~f~~~I~fp~~YP~~~~pP~V~F~t~IfHPnV~~~~G~vCl~~l~e~W  136 (180)
                      .++|+++|+++|.||+      +|+|+||   +|+|.|.||++||+  +||+|+|.|+||||||+ .+|.||+++|.++|
T Consensus        29 ~~~nl~~w~~~i~Gp~------~tpyegg---~f~~~i~fp~~YP~--~pP~v~f~t~i~HPnv~-~~G~iCl~iL~~~W   96 (151)
T 4gpr_A           29 VGDDIFHWTATITGPD------DSPYQGG---LFFLDVHFPVDYPF--KAPRVTFMTKVYHPNIN-KNGVICLDILKDQW   96 (151)
T ss_dssp             SSSCTTEEEEEEECCS------SSTTTTC---EEEEEEECCTTTTS--SCCEEEESSCCCBTTBC-TTCBBCCGGGTTTC
T ss_pred             cCCCceEEEEEEeCCC------CCCcCCC---EEEEEEECCCCCCC--CcceeEEecCcccceEC-CCCEEEcccccCCC
Confidence            3579999999999999      9999999   99999999999999  99999999999999999 69999999999999


Q ss_pred             CCCCChHHHHHHHHHHHhcCCCCCCCccHHHHHHHhhCHHhHhC
Q psy7478         137 TPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE  180 (180)
Q Consensus       137 sP~~tl~~iL~~Ii~~ll~~P~~~~p~N~eaA~ly~~d~~~F~k  180 (180)
                      +|++||.+||++| ++||.+|++++|+|.+||.+|++|++.|.+
T Consensus        97 ~p~~~i~~vl~~i-~~ll~~p~~~~p~n~~aa~~~~~d~~~f~~  139 (151)
T 4gpr_A           97 SPALTLSRVLLSI-SSLLTDPNPSDPLDPEVANVLRANKKQFED  139 (151)
T ss_dssp             CTTCCHHHHHHHH-HHHHHCCCTTSCSSHHHHHHHHHCHHHHHH
T ss_pred             CCCCcHHHHHHHH-HHHhcCCCCCCchhHHHHHHHHHCHHHHHH
Confidence            9999999999999 799999999999999999999999999964
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 5e-11
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 2e-10
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-10
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-10
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 8e-10
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 8e-10
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 1e-09
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 3e-09
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-09
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 3e-09
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 3e-09
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 5e-09
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 7e-09
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-08
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 3e-08
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 3e-08
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 4e-08
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 2e-07
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 3e-07
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 3e-07
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 3e-06
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-05
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 4e-05
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 0.001
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 0.002
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 0.004
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]

 Score = 55.9 bits (134), Expect = 5e-11
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 104 QGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEWTPLYDLSNIFETFLPQLLTYPNPTDPL 163
              PP V   S   H +    G++CL+++   W+P YD++ I  T +  LL  PNP  P 
Sbjct: 63  PNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAIL-TSIQSLLDEPNPNSPA 121

Query: 164 NGDAAAMYLDKPDKYKE 180
           N  AA +Y +   +Y++
Sbjct: 122 NSLAAQLYQENRREYEK 138
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.98
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.98
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.98
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.95
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.95
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.94
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.93
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.92
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.6
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.52
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 90.56
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 84.09
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 83.58
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 80.26
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Hypothetical protein Tgtwinscan 2721, E2 domain
species: Toxoplasma gondii [TaxId: 5811]

Probab=100.00  E-value=9.2e-35  Score=228.46  Aligned_cols=112  Identities=21%  Similarity=0.421  Sum_probs=107.1

Q ss_pred             cCCCccceEEEEecCCCCCCCCCCCCCCCCCCeeEEEEEecCCCCCCCCCCcEeeCCCcccCCCCCCCCeEEeccCCCCC
Q psy7478          57 EGEKRRTLTFIRIGKPALKPRPTRCVEGEGAPTRTLSVQIPLHRVHEQGVPPVVYPPSIYNHQSTLYSGTVCLNVINQEW  136 (180)
Q Consensus        57 eg~nl~~W~~~I~Gp~~~~~~p~tpy~ggg~~~f~~~I~fp~~YP~~~~pP~V~F~t~IfHPnV~~~~G~vCl~~l~e~W  136 (180)
                      .++|+++|+++|+||.      +|+|+||   +|+|.|.||++||+  .||+|+|.|+||||||+..+|.||++++.+.|
T Consensus        39 ~~~nl~~W~~~I~Gp~------~TpY~gg---~f~~~i~fp~~YP~--~pP~V~F~t~i~HPni~~~~G~icl~~l~~~W  107 (161)
T d2f4za1          39 VGGDIHRWRGFIAGPL------GTPYEGG---HFTLDIVIPPDYPY--NPPKMKFVTKIWHPNISSQTGAICLDILKHEW  107 (161)
T ss_dssp             ETTEEEEEEEEEECCT------TSTTTTC---EEEEEEECCTTTTT--SCCEEEESSCCCBTTBCTTTCBBCCGGGTTTC
T ss_pred             cCCccceeEEEEeCCC------CCccCCC---EEEEEEeccCCCCC--CCcEEEecCCCCCCceECCCCCeecCcccccC
Confidence            4579999999999999      9999999   99999999999999  99999999999999998779999999999999


Q ss_pred             CCCCChHHHHHHHHHHHhcCCCCCCCccHHHHHHHhhCHHhHhC
Q psy7478         137 TPLYDLSNIFETFLPQLLTYPNPTDPLNGDAAAMYLDKPDKYKE  180 (180)
Q Consensus       137 sP~~tl~~iL~~Ii~~ll~~P~~~~p~N~eaA~ly~~d~~~F~k  180 (180)
                      +|+++|.+||.+| +.||.+|++++|+|.+||.+|++|++.|.+
T Consensus       108 ~p~~si~~iL~~I-~~ll~~P~~~dp~n~eaa~l~~~d~~~y~~  150 (161)
T d2f4za1         108 SPALTIRTALLSI-QAMLADPVPTDPQDAEVAKMMIENHPLFVQ  150 (161)
T ss_dssp             CTTSCHHHHHHHH-HHHHHSCCTTSCSCHHHHHHHHHCHHHHHH
T ss_pred             CCcccHHHHHHHH-HHHHhCCCCCCchhHHHHHHHHHCHHHHHH
Confidence            9999999999999 699999999999999999999999999963
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure