Diaphorina citri psyllid: psy7482

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------

KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLSSYGVGFENLDSVVWSPEGLLYAIPIQNKAVVFSVEKAGVLQTLKSESKVHSVCFLNETTVCTGNEESAITAYNLTDGSHLWQIKASASRIKGLVFFSIPQETTVCTGNEESAITAYNLTDGSHLWHIKASASRIKGLASHRNHLICITSAGDLVVWELNEDVTREPQRVSATNDGCRFTCLAIRPPVV

cEEEEEEcEEccccEEEEEEcccccEEEEEcccccEEEEEccccCEEEEEccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEEccccccccccEEEEEEcccccEEEEECcccEEEEEcccccEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccccEEEEEcccccEEEEEccccCEEEEEEcccccEEEEEEcccccEEEEccccEEEEEcccccccccEEEEccccccCEEEEEECcccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
p21-activated protein kinase-interacting protein 1	Negatively regulates the PAK1 kinase. The PAK kinase family have been shown to play a positive role in the regulation of signaling by pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42.	confident	Q5EA99
p21-activated protein kinase-interacting protein 1-like	Negatively regulates the PAK1 kinase.	confident	Q5ZKU8
p21-activated protein kinase-interacting protein 1	Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which have been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42.	confident	Q9NWT1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005840 [CC]	ribosome	probable	GO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0080008 [CC]	Cul4-RING ubiquitin ligase complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 9-326
View the alignment between query and template
View the model in PyMOL