Diaphorina citri psyllid: psy74

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEFCTV
cEEEEEcccccccEECccEEEEEEcccEEEEEcccccCEEEEEEccccccccEEEEEcccccEEEEEECccccccccEEEEEEccccccccccccccccccccEEEEEEccEEEEEccccEEEEEcccccEEEc
MVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMI****************TGISAVWVARNRFAVLDRNHTILIKNLKNEFC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVFKFERERPAYTVHNNVMYYVKERFLHRLDLTNSKDSVVMQLRGGGRIPAHSISYNATEHSILVTTRNANNFENSTYDLYMIPKEESERKEVADGKRSTGISAVWVARNRFAVLDRNHTILIKNLKNEFCTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit alpha Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.confidentQ8CIE6
Coatomer subunit alpha Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.confidentP53621
Coatomer subunit alpha Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.confidentQ27954

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010883 [BP]regulation of lipid storageprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0030157 [BP]pancreatic juice secretionprobableGO:0051234, GO:0046903, GO:0032501, GO:0022600, GO:0050878, GO:0044707, GO:0007589, GO:0007586, GO:0006810, GO:0044765, GO:0032941, GO:0008150, GO:0065007, GO:0065008, GO:0051179, GO:0044699, GO:0003008
GO:0030126 [CC]COPI vesicle coatprobableGO:0012506, GO:0043229, GO:0030117, GO:0005622, GO:0030135, GO:0043226, GO:0030137, GO:0005737, GO:0005575, GO:0030660, GO:0030663, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0031982, GO:0048475, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0043227, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKQ, chain A
Confidence level:confident
Coverage over the Query: 48-125
View the alignment between query and template
View the model in PyMOL
Template: 1K8K, chain C
Confidence level:probable
Coverage over the Query: 3-129
View the alignment between query and template
View the model in PyMOL