Diaphorina citri psyllid: psy7515


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MHYLDSKQWDNYLKARPGASKSPEGTGLDNEPTMAKVHVFKAEMTCDGCSSAITRILDRMKDKGVESVECSLPDQTVKVKSTLDPDVLLEAIKKSGKTCSYIGEGS
ccccccHHHHHHHHcccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHccccCEEEEEEccccEEEEECcccHHHHHHHHHHccccEEEECccc
***********************************KVHVFKAEMTCDGCSSAITRILDRMKDKGVESVECSLPDQTVKVKSTLDPDVLLEAIKKSGKTCSYIGE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHYLDSKQWDNYLKARPGASKSPEGTGLDNEPTMAKVHVFKAEMTCDGCSSAITRILDRMKDKGVESVECSLPDQTVKVKSTLDPDVLLEAIKKSGKTCSYIGEGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Copper transport protein ATOX1 homolog Could bind and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.confidentQ54PZ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055070 [BP]copper ion homeostasisprobableGO:0050801, GO:0048878, GO:0042592, GO:0065007, GO:0055080, GO:0008150, GO:0065008
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P6T, chain A
Confidence level:very confident
Coverage over the Query: 36-104
View the alignment between query and template
View the model in PyMOL
Template: 1UWD, chain A
Confidence level:probable
Coverage over the Query: 8-74
View the alignment between query and template
View the model in PyMOL