Diaphorina citri psyllid: psy7549


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MRRQHAGNYYEPVPNQFDGGDAIHQENEQLTSDLRNKIQALKSLTIDIGTEVKYQNEHLLRGMDDDFDRTGGFLNNSMARVVLDIEKIKNPNIDRGLQTYKTPT
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccc
***********************************NKIQALKSLTIDIGTEVKYQNEHLLRGMDDDFDRTGGFLNNSMARVVLDIEKIKN*******QTYK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRQHAGNYYEPVPNQFDGGDAIHQENEQLTSDLRNKIQALKSLTIDIGTEVKYQNEHLLRGMDDDFDRTGGFLNNSMARVVLDIEKIKNPNIDRGLQTYKTPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BET1 homolog Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.confidentQ62896
BET1 homolog Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.confidentO15155
BET1 homolog Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.confidentO35623

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031985 [CC]Golgi cisternaprobableGO:0005795, GO:0005794, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048280 [BP]vesicle fusion with Golgi apparatusprobableGO:0006906, GO:0061025, GO:0061024, GO:0006944, GO:0044699, GO:0016044, GO:0016043, GO:0071840, GO:0009987, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0016192, GO:0046907, GO:0016050, GO:0048284, GO:0044763
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GL2, chain D
Confidence level:very confident
Coverage over the Query: 28-83
View the alignment between query and template
View the model in PyMOL