Diaphorina citri psyllid: psy7554


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MSLRPATHYQVNLLTGTPDQVYLSYLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALKHTGLKVDLTTES
ccccccccccccccccccccccEEEEECcccccccHHHHHHHccccccCEEEcccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccc
*******HYQVNLLTGTPDQVYLSYLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALKHTGLKVDLTTES
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLRPATHYQVNLLTGTPDQVYLSYLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALKHTGLKVDLTTES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate isopentenyltransferase 5, chloroplastic Involved in cytokinin biosynthesis. Catalyzes the transfer of an isopentenyl group from dimethylallyl diphosphate (DMAPP) to ATP and ADP.confidentQ94ID2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D3Q, chain A
Confidence level:very confident
Coverage over the Query: 25-111
View the alignment between query and template
View the model in PyMOL
Template: 3LXX, chain A
Confidence level:probable
Coverage over the Query: 21-46
View the alignment between query and template
View the model in PyMOL