Psyllid ID: psy7554
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 391325368 | 375 | PREDICTED: tRNA dimethylallyltransferase | 0.4 | 0.122 | 0.673 | 1e-11 | |
| 390358716 | 637 | PREDICTED: tRNA dimethylallyltransferase | 0.4 | 0.072 | 0.652 | 2e-10 | |
| 346468251 | 476 | hypothetical protein [Amblyomma maculatu | 0.4 | 0.096 | 0.630 | 3e-10 | |
| 357621627 | 197 | hypothetical protein KGM_06386 [Danaus p | 0.417 | 0.243 | 0.583 | 2e-09 | |
| 325112798 | 334 | adenylate isopentenyltransferase [Malus | 0.391 | 0.134 | 0.6 | 3e-09 | |
| 91092888 | 419 | PREDICTED: similar to tRNA isopentenyltr | 0.408 | 0.112 | 0.617 | 4e-09 | |
| 427792927 | 479 | Putative trna delta2-isopentenylpyrophos | 0.4 | 0.096 | 0.608 | 4e-09 | |
| 449676452 | 326 | PREDICTED: tRNA dimethylallyltransferase | 0.4 | 0.141 | 0.586 | 6e-09 | |
| 194067759 | 319 | adenylate isopentenyltransferase [Ipomoe | 0.408 | 0.147 | 0.553 | 1e-08 | |
| 198423736 | 461 | PREDICTED: similar to Trit1 protein [Cio | 0.408 | 0.101 | 0.531 | 1e-08 |
| >gi|391325368|ref|XP_003737209.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like, partial [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
Score = 73.9 bits (180), Expect = 1e-11, Method: Composition-based stats.
Identities = 31/46 (67%), Positives = 37/46 (80%)
Query: 57 LMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRAL 102
+ VYK LDV TNKVT EE G+PHH++DF+DP FTVVD+RNRAL
Sbjct: 49 MQVYKNLDVTTNKVTAEEMAGVPHHIIDFVDPVDSFTVVDFRNRAL 94
|
Source: Metaseiulus occidentalis Species: Metaseiulus occidentalis Genus: Metaseiulus Family: Phytoseiidae Order: Mesostigmata Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|390358716|ref|XP_791099.3| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|346468251|gb|AEO33970.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|357621627|gb|EHJ73402.1| hypothetical protein KGM_06386 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|325112798|gb|ADY80560.1| adenylate isopentenyltransferase [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|91092888|ref|XP_970625.1| PREDICTED: similar to tRNA isopentenyltransferase 1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|427792927|gb|JAA61915.1| Putative trna delta2-isopentenylpyrophosphate transferase, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|449676452|ref|XP_004208631.1| PREDICTED: tRNA dimethylallyltransferase, mitochondrial-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|194067759|dbj|BAG55007.1| adenylate isopentenyltransferase [Ipomoea nil] | Back alignment and taxonomy information |
|---|
| >gi|198423736|ref|XP_002120555.1| PREDICTED: similar to Trit1 protein [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| UNIPROTKB|B4E3K2 | 144 | TRIT1 "tRNA dimethylallyltrans | 0.391 | 0.312 | 0.543 | 4.7e-09 | |
| ZFIN|ZDB-GENE-060503-297 | 455 | trit1 "tRNA isopentenyltransfe | 0.4 | 0.101 | 0.574 | 6.7e-09 | |
| TAIR|locus:2179629 | 330 | IPT5 "isopentenyltransferase 5 | 0.408 | 0.142 | 0.520 | 1.2e-08 | |
| UNIPROTKB|F1Q3P4 | 468 | TRIT1 "Uncharacterized protein | 0.391 | 0.096 | 0.543 | 1.9e-08 | |
| UNIPROTKB|E1C6R1 | 459 | TRIT1 "Uncharacterized protein | 0.4 | 0.100 | 0.510 | 3e-08 | |
| RGD|1304781 | 479 | Trit1 "tRNA isopentenyltransfe | 0.391 | 0.093 | 0.543 | 3.2e-08 | |
| UNIPROTKB|Q9H3H1 | 467 | TRIT1 "tRNA dimethylallyltrans | 0.391 | 0.096 | 0.543 | 4e-08 | |
| MGI|MGI:1914216 | 467 | Trit1 "tRNA isopentenyltransfe | 0.391 | 0.096 | 0.521 | 5.1e-08 | |
| UNIPROTKB|F1SMC5 | 413 | TRIT1 "Uncharacterized protein | 0.373 | 0.104 | 0.545 | 6.8e-08 | |
| UNIPROTKB|Q5GHF7 | 329 | Q5GHF7 "Adenylate isopentenylt | 0.408 | 0.142 | 0.458 | 1.9e-07 |
| UNIPROTKB|B4E3K2 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 134 (52.2 bits), Expect = 4.7e-09, P = 4.7e-09
Identities = 25/46 (54%), Positives = 35/46 (76%)
Query: 57 LMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPN-TRFTVVDYRNRA 101
+ VY+GLD+ITNKV+ +E HH++ F+DP T +TVVD+RNRA
Sbjct: 57 MQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRA 102
|
|
| ZFIN|ZDB-GENE-060503-297 trit1 "tRNA isopentenyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179629 IPT5 "isopentenyltransferase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q3P4 TRIT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6R1 TRIT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1304781 Trit1 "tRNA isopentenyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H3H1 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914216 Trit1 "tRNA isopentenyltransferase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SMC5 TRIT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5GHF7 Q5GHF7 "Adenylate isopentenyltransferase" [Humulus lupulus (taxid:3486)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| PRK00091 | 307 | PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp | 7e-16 | |
| COG0324 | 308 | COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph | 5e-15 | |
| pfam01715 | 253 | pfam01715, IPPT, IPP transferase | 3e-13 | |
| TIGR00174 | 287 | TIGR00174, miaA, tRNA dimethylallyltransferase | 2e-12 | |
| PLN02748 | 468 | PLN02748, PLN02748, tRNA dimethylallyltransferase | 4e-12 | |
| PLN02165 | 334 | PLN02165, PLN02165, adenylate isopentenyltransfera | 2e-08 | |
| PLN02840 | 421 | PLN02840, PLN02840, tRNA dimethylallyltransferase | 5e-08 | |
| PRK14729 | 300 | PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosp | 0.001 |
| >gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
Score = 70.5 bits (174), Expect = 7e-16
Identities = 22/47 (46%), Positives = 32/47 (68%)
Query: 57 LMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALK 103
+ VY+G+D+ T K T EE G+PHHL+D LDP ++V D++ AL
Sbjct: 38 MQVYRGMDIGTAKPTAEERAGVPHHLIDILDPTESYSVADFQRDALA 84
|
Length = 307 |
| >gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216659 pfam01715, IPPT, IPP transferase | Back alignment and domain information |
|---|
| >gnl|CDD|213512 TIGR00174, miaA, tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215399 PLN02748, PLN02748, tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177823 PLN02165, PLN02165, adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215451 PLN02840, PLN02840, tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173191 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 100.0 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 100.0 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 100.0 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 100.0 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 99.97 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 99.97 | |
| KOG1384|consensus | 348 | 99.97 | ||
| PLN02165 | 334 | adenylate isopentenyltransferase | 99.97 | |
| PF01715 | 253 | IPPT: IPP transferase; InterPro: IPR002627 tRNA is | 99.85 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 99.79 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 99.33 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 98.93 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 98.66 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 98.58 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 98.48 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.44 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 98.29 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 98.24 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 98.14 | |
| PRK06217 | 183 | hypothetical protein; Validated | 98.12 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 98.07 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 98.04 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.01 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 98.0 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 97.98 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 97.97 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 97.93 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 97.91 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 97.91 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.9 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 97.9 | |
| PRK03839 | 180 | putative kinase; Provisional | 97.88 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 97.86 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 97.85 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 97.83 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.77 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 97.76 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.75 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 97.74 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 97.73 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.7 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 97.7 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.7 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 97.7 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 97.69 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.67 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 97.66 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 97.66 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 97.65 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.63 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 97.6 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 97.58 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 97.58 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 97.56 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 97.54 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 97.54 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 97.52 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.5 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 97.5 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 97.49 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 97.47 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.46 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.45 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 97.44 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 97.42 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 97.42 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 97.4 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 97.4 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 97.4 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 97.39 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.39 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 97.39 | |
| PLN02200 | 234 | adenylate kinase family protein | 97.37 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 97.36 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 97.35 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.34 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 97.34 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 97.34 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 97.33 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 97.32 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 97.3 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 97.3 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.28 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.28 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 97.26 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 97.26 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 97.24 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.24 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 97.23 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 97.22 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.21 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 97.18 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 97.18 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.18 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.17 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 97.17 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 97.15 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 97.15 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.14 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 97.12 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 97.12 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 97.11 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.11 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.1 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.1 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 97.1 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.09 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 97.08 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 97.08 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 97.06 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 97.04 | |
| PF02283 | 167 | CobU: Cobinamide kinase / cobinamide phosphate gua | 97.04 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 97.02 | |
| COG1493 | 308 | HprK Serine kinase of the HPr protein, regulates c | 97.0 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.99 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.98 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.95 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 96.94 | |
| PF07475 | 171 | Hpr_kinase_C: HPr Serine kinase C-terminal domain; | 96.94 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 96.94 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 96.93 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.92 | |
| PLN02772 | 398 | guanylate kinase | 96.91 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.91 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 96.91 | |
| KOG0745|consensus | 564 | 96.87 | ||
| PRK05428 | 308 | HPr kinase/phosphorylase; Provisional | 96.87 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 96.85 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.85 | |
| PLN02674 | 244 | adenylate kinase | 96.84 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.84 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 96.84 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 96.84 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.84 | |
| TIGR00679 | 304 | hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene | 96.83 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.81 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.8 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.79 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 96.79 | |
| PLN02199 | 303 | shikimate kinase | 96.75 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 96.75 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.75 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.74 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 96.73 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.73 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.73 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.72 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 96.7 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 96.69 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.66 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.66 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.63 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.63 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.62 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.61 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 96.6 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.6 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.6 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 96.6 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 96.58 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.58 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 96.58 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.58 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.57 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 96.57 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 96.56 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 96.56 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.56 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.55 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 96.54 | |
| PRK06526 | 254 | transposase; Provisional | 96.54 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 96.5 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.49 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 96.49 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 96.48 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.48 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 96.47 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 96.46 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 96.46 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.45 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.44 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 96.44 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.43 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.43 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.43 | |
| PHA02244 | 383 | ATPase-like protein | 96.43 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.42 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.42 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.42 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.42 | |
| KOG3347|consensus | 176 | 96.41 | ||
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.4 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 96.4 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 96.4 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 96.39 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.39 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.39 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.38 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 96.37 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 96.37 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.37 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.36 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 96.36 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 96.35 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.35 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.35 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.35 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.34 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.34 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 96.34 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.34 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 96.33 | |
| PLN02348 | 395 | phosphoribulokinase | 96.32 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 96.31 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.3 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 96.28 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 96.26 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.25 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.25 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.25 | |
| COG2087 | 175 | CobU Adenosyl cobinamide kinase/adenosyl cobinamid | 96.24 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 96.23 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 96.23 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.23 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.21 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.21 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.21 | |
| PRK13764 | 602 | ATPase; Provisional | 96.2 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.19 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.18 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.18 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 96.17 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 96.16 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.16 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.16 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.16 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 96.16 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.15 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.15 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.14 | |
| PRK08181 | 269 | transposase; Validated | 96.13 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.13 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.13 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 96.12 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 96.11 | |
| KOG0741|consensus | 744 | 96.1 | ||
| KOG1942|consensus | 456 | 96.08 | ||
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.08 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 96.06 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.05 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.05 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 96.04 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 96.03 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.03 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.03 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.02 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 96.02 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.01 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.01 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.0 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 96.0 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.98 | |
| PLN02422 | 232 | dephospho-CoA kinase | 95.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.96 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.94 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 95.93 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 95.93 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 95.93 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 95.91 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 95.91 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.91 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.9 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 95.89 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.88 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.88 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 95.88 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.87 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.86 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 95.86 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.86 | |
| PLN02459 | 261 | probable adenylate kinase | 95.85 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 95.84 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 95.84 | |
| PLN02842 | 505 | nucleotide kinase | 95.83 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.83 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 95.83 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 95.82 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 95.82 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 95.82 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.82 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 95.82 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.81 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 95.8 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 95.8 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 95.78 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 95.77 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 95.76 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.76 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.76 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 95.75 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.75 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 95.75 | |
| KOG0744|consensus | 423 | 95.74 | ||
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.74 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.74 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 95.73 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.73 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 95.73 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.72 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.72 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.72 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 95.72 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 95.72 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.72 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.71 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.71 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 95.7 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.69 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.69 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 95.68 | |
| KOG3308|consensus | 225 | 95.68 | ||
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.68 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.68 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 95.67 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 95.66 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.66 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 95.66 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 95.65 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 95.65 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.65 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.65 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 95.64 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.63 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 95.63 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 95.62 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 95.62 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.62 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 95.62 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 95.61 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 95.61 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 95.61 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 95.61 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.61 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.6 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 95.6 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.6 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 95.59 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 95.59 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 95.58 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 95.58 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 95.58 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.58 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.57 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 95.57 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 95.57 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 95.56 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 95.56 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 95.55 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 95.55 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 95.55 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 95.54 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 95.53 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.53 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 95.53 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.53 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.52 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 95.52 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 95.52 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 95.51 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 95.51 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 95.49 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.49 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.49 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 95.49 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 95.48 | |
| PF13479 | 213 | AAA_24: AAA domain | 95.48 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.48 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 95.47 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.47 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 95.47 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.47 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 95.47 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 95.46 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.46 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 95.46 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 95.45 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 95.45 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.45 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 95.44 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 95.44 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 95.44 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 95.43 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 95.43 | |
| PHA02624 | 647 | large T antigen; Provisional | 95.42 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 95.42 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.41 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.41 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.41 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.4 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 95.4 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 95.4 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 95.39 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 95.39 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 95.39 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 95.38 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 95.37 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.37 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 95.37 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.36 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 95.35 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.35 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 95.35 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 95.35 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 95.34 | |
| PRK13768 | 253 | GTPase; Provisional | 95.34 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.34 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 95.33 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 95.33 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 95.32 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 95.32 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 95.32 | |
| KOG3354|consensus | 191 | 95.31 | ||
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 95.3 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.3 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 95.3 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 95.29 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 95.29 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 95.29 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.29 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 95.29 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 95.29 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.29 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 95.27 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 95.26 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 95.26 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 95.26 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 95.26 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 95.26 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 95.26 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 95.26 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 95.25 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 95.25 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 95.25 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 95.25 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 95.24 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 95.24 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 95.23 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 95.22 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 95.21 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 95.21 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 95.2 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 95.2 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 95.2 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.2 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 95.2 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 95.19 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 95.18 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 95.18 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 95.18 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 95.17 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 95.17 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 95.17 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 95.16 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.15 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 95.15 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 95.15 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.15 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 95.15 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 95.14 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.13 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 95.13 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 95.12 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 95.12 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 95.12 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 95.12 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 95.12 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 95.11 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 95.1 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 95.1 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.1 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 95.1 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 95.09 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 95.09 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 95.08 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 95.08 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 95.08 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.08 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 95.06 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 95.06 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 95.06 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 95.06 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.06 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 95.05 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 95.05 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 95.05 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.05 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 95.04 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 95.04 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 95.04 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 95.03 |
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-39 Score=265.06 Aligned_cols=86 Identities=23% Similarity=0.269 Sum_probs=83.4
Q ss_pred eeeeccCCCchhHHHHHHhcCCCceEeeccceeeeccCCceecCCCCHHHhcCCCeeeecccCCCCccCHHHHHHHHHHH
Q psy7554 25 YLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALKH 104 (115)
Q Consensus 25 ~li~GpTasGKS~lai~LA~~~~~eI~IsaDSmQVYkgldIgTAKPs~eE~~~IpHHLid~ldp~e~ySv~~F~~~A~~~ 104 (115)
++|+||||||||+||++||++ ++|| ||||||||||+|||||||||.+|+++|||||||+++|+++|||++|+++|.++
T Consensus 7 i~I~GpTasGKS~LAl~LA~~-~~eI-IsaDS~QvYr~ldIgTaKpt~eE~~~i~Hhlid~~~p~e~~sv~~f~~~a~~~ 84 (300)
T PRK14729 7 VFIFGPTAVGKSNILFHFPKG-KAEI-INVDSIQVYKEFDIASCKPSKELRKHIKHHLVDFLEPIKEYNLGIFYKEALKI 84 (300)
T ss_pred EEEECCCccCHHHHHHHHHHh-CCcE-EeccHHHHHCCCceecCCCCHHHHcCCCeeeeeccCCCCceeHHHHHHHHHHH
Confidence 468999999999999999999 7899 99999999999999999999999999999999999999999999999999999
Q ss_pred Hhhhhhcc
Q psy7554 105 TGLKVDLT 112 (115)
Q Consensus 105 I~~i~~~~ 112 (115)
|++++++.
T Consensus 85 i~~i~~~g 92 (300)
T PRK14729 85 IKELRQQK 92 (300)
T ss_pred HHHHHHCC
Confidence 99999885
|
|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1384|consensus | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF01715 IPPT: IPP transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2 | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PRK05428 HPr kinase/phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG1942|consensus | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >KOG3308|consensus | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >KOG3354|consensus | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 115 | ||||
| 2qgn_A | 322 | Crystal Structure Of Trna Isopentenylpyrophosphate | 2e-08 | ||
| 3d3q_A | 340 | Crystal Structure Of Trna Delta(2)-Isopentenylpyrop | 7e-08 | ||
| 3foz_A | 316 | Structure Of E. Coli Isopentenyl-Trna Transferase I | 6e-06 | ||
| 3a8t_A | 339 | Plant Adenylate Isopentenyltransferase In Complex W | 7e-06 | ||
| 2zm5_A | 316 | Crystal Structure Of Trna Modification Enzyme Miaa | 2e-05 |
| >pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate Transferase (Bh2366) From Bacillus Halodurans, Northeast Structural Genomics Consortium Target Bhr41. Length = 322 | Back alignment and structure |
|
| >pdb|3D3Q|A Chain A, Crystal Structure Of Trna Delta(2)-Isopentenylpyrophosphate Transferase (Se0981) From Staphylococcus Epidermidis. Northeast Structural Genomics Consortium Target Ser100 Length = 340 | Back alignment and structure |
| >pdb|3FOZ|A Chain A, Structure Of E. Coli Isopentenyl-Trna Transferase In Complex With E. Coli Trna(Phe) Length = 316 | Back alignment and structure |
| >pdb|3A8T|A Chain A, Plant Adenylate Isopentenyltransferase In Complex With Atp Length = 339 | Back alignment and structure |
| >pdb|2ZM5|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The Complex With Trna(Phe) Length = 316 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 4e-20 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 2e-18 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 6e-17 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 7e-17 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 2e-16 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 5e-16 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 3e-14 |
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Length = 409 | Back alignment and structure |
|---|
Score = 82.8 bits (205), Expect = 4e-20
Identities = 15/45 (33%), Positives = 26/45 (57%)
Query: 59 VYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALK 103
VYK + +ITNK +E EGIPHH+++ +D + + + +
Sbjct: 38 VYKDIPIITNKHPLQEREGIPHHVMNHVDWSEEYYSHRFETECMN 82
|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Length = 339 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Length = 316 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Length = 323 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Length = 322 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 340 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Length = 253 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 99.98 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 99.97 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 99.97 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 99.97 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 99.94 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 99.93 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 99.83 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 99.82 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.49 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 98.3 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.23 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.14 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 98.03 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.96 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.94 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 97.93 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.91 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.9 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.87 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 97.85 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 97.85 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.85 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.83 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 97.83 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.81 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.81 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.81 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 97.8 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.79 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 97.79 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.78 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.78 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.77 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.76 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.76 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.76 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 97.75 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 97.71 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 97.7 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 97.68 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.68 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.67 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.67 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.67 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.67 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 97.67 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 97.66 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.64 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.63 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.63 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 97.62 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 97.61 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.61 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.61 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.59 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 97.58 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.57 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.56 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.55 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 97.55 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.54 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.53 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 97.53 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 97.52 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.49 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.47 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 97.45 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.45 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.44 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 97.42 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.41 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.4 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.37 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 97.36 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 97.36 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.35 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.35 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.34 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.34 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 97.32 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.31 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 97.31 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.3 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.28 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.28 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.27 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.27 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.26 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.25 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.24 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.24 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.24 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.23 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 97.21 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.21 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.21 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.2 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.18 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.17 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 97.17 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.17 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.15 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.14 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.13 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.09 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.08 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.08 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.07 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.07 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.06 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.06 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.02 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.02 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 97.02 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.01 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.01 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.0 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.97 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.97 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.96 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.95 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.95 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.95 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.93 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.89 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 96.89 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.88 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.87 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.85 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.83 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.81 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.8 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.79 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 96.78 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.74 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.73 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.71 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.69 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.69 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 96.68 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.67 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.67 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.65 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.65 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.64 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.62 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.59 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.59 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.57 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.57 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.56 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.56 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.55 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.55 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.55 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.54 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.52 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 96.52 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 96.51 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.51 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.5 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.49 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.49 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.46 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.46 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.45 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.45 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.43 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 96.43 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.42 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.42 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.39 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.38 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.37 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.35 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.35 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.34 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.33 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.27 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.25 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.24 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 96.22 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.2 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 96.19 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.12 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 96.11 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.09 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.06 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 96.05 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.04 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.02 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.02 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.01 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.0 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 95.99 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 95.99 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.98 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 95.95 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 95.95 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.93 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 95.92 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 95.91 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.9 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.9 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.9 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 95.87 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.87 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.87 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.86 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.85 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.83 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 95.83 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 95.82 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.82 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 95.81 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 95.8 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.79 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 95.79 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.79 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.78 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.78 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.76 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.76 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.75 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 95.75 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 95.71 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 95.71 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 95.71 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 95.69 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 95.68 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 95.68 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 95.62 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 95.62 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.62 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 95.61 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 95.61 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 95.59 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 95.57 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 95.57 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 95.57 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 95.56 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.55 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 95.55 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.53 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.53 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 95.52 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.51 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.5 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.49 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.47 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.47 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.45 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.45 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 95.45 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.44 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.44 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 95.43 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.43 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.42 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 95.41 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.4 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.39 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 95.38 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.38 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 95.38 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 95.36 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 95.36 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.36 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 95.34 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.34 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 95.32 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 95.31 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 95.29 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 95.29 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 95.28 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.28 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 95.27 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 95.27 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 95.27 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 95.26 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 95.26 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.24 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 95.23 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.23 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 95.23 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.21 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 95.2 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.2 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.2 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 95.19 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.18 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.17 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.17 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 95.17 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.17 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 95.16 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.14 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.13 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 95.13 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 95.13 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 95.11 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.11 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 95.08 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.08 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.08 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 95.06 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 95.06 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 95.04 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.04 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.04 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 95.04 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 95.03 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.03 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 95.02 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.02 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.0 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 95.0 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 95.0 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 94.97 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 94.97 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 94.95 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 94.94 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 94.94 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.94 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 94.92 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 94.92 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 94.91 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.9 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 94.88 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 94.87 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 94.87 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.87 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 94.86 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 94.84 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.84 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 94.82 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 94.81 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 94.8 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.78 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.78 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.78 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 94.76 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 94.75 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 94.75 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 94.74 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 94.74 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.74 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 94.73 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 94.73 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.73 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 94.73 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 94.73 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 94.73 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.72 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 94.71 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.7 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 94.69 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 94.68 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 94.68 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 94.67 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 94.66 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 94.64 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 94.64 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.63 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 94.63 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 94.62 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 94.62 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 94.61 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 94.6 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 94.59 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 94.58 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.58 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 94.57 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 94.56 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.56 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 94.55 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 94.53 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.52 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 94.5 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 94.47 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 94.47 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 94.45 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 94.45 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.43 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 94.42 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 94.4 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 94.39 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 94.38 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 94.37 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 94.37 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 94.34 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 94.34 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 94.33 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 94.32 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 94.32 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 94.31 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 94.28 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 94.28 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 94.28 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 94.27 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 94.27 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 94.26 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 94.25 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 94.25 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 94.23 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 94.2 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 94.19 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 94.18 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 94.16 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.14 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 94.12 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 94.12 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 94.12 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 94.1 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 94.1 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 94.09 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 94.09 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 94.08 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 94.08 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 94.07 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 94.07 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 94.06 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 94.05 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 94.04 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 94.01 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 94.01 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 93.97 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 93.96 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 93.94 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 93.93 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 93.91 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 93.89 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 93.87 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 93.86 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 93.84 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 93.83 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 93.83 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 93.82 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 93.81 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 93.79 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 93.77 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 93.74 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 93.74 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 93.73 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 93.72 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 93.71 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 93.71 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 93.68 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 93.67 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 93.66 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 93.6 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 93.59 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 93.59 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 93.5 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 93.49 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 93.47 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.47 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 93.46 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 93.46 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 93.43 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 93.41 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 93.41 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 93.35 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.34 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.32 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 93.31 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 93.3 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 93.3 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 93.23 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 93.23 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 93.22 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 93.21 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 93.21 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 93.2 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 93.18 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 93.15 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 93.15 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 93.12 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 93.07 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 93.04 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 93.04 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 93.03 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 93.02 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 93.01 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 93.0 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 92.98 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 92.98 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 92.95 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 92.93 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 92.9 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 92.89 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 92.88 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 92.87 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 92.85 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 92.84 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 92.82 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 92.78 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.72 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 92.64 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 92.55 |
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
Probab=99.98 E-value=4.1e-33 Score=227.54 Aligned_cols=87 Identities=29% Similarity=0.393 Sum_probs=84.6
Q ss_pred eeeeccCCCchhHHHHHHhcCCCceEeeccceeeeccCCceecCCCCHHHhcCCCeeeecccCCCCccCHHHHHHHHHHH
Q psy7554 25 YLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDVITNKVTPEEAEGIPHHLLDFLDPNTRFTVVDYRNRALKH 104 (115)
Q Consensus 25 ~li~GpTasGKS~lai~LA~~~~~eI~IsaDSmQVYkgldIgTAKPs~eE~~~IpHHLid~ldp~e~ySv~~F~~~A~~~ 104 (115)
++|+||||||||+||++||++++++| ||+|||||||+|+||||||+++|+++|||||||+++|++.||+++|+++|.++
T Consensus 6 i~i~GptgsGKt~la~~La~~~~~~i-is~Ds~QvYr~~~igTakp~~~E~~gvphhlid~~~~~e~~s~~~F~~~a~~~ 84 (322)
T 3exa_A 6 VAIVGPTAVGKTKTSVMLAKRLNGEV-ISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPL 84 (322)
T ss_dssp EEEECCTTSCHHHHHHHHHHTTTEEE-EECCGGGGBTTCCTTTTCCCHHHHTTCCEESSSCBCTTSCCCHHHHHHHHHHH
T ss_pred EEEECCCcCCHHHHHHHHHHhCccce-eecCcccceeeeeecCCCCCHHHHcCCCEEEeccCChhhhccHHHHHHHHHHH
Confidence 56899999999999999999999999 99999999999999999999999999999999999999999999999999999
Q ss_pred Hhhhhhcc
Q psy7554 105 TGLKVDLT 112 (115)
Q Consensus 105 I~~i~~~~ 112 (115)
|++++++.
T Consensus 85 i~~i~~~g 92 (322)
T 3exa_A 85 ITEIHERG 92 (322)
T ss_dssp HHHHHHTT
T ss_pred HHHHHhCC
Confidence 99999873
|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.49 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.45 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 98.32 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.3 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 98.3 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 98.25 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 98.25 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 98.23 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 98.11 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 98.06 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.03 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.03 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.03 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 98.02 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 98.01 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 98.01 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.96 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.96 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.95 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.94 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.93 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.91 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.89 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 97.88 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.88 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.88 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.88 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.83 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 97.83 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.82 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.81 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.79 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.78 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.76 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.75 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.74 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.7 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.69 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 97.68 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.63 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.59 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.58 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.56 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 97.56 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.48 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.47 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.44 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.43 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.43 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.39 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.36 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.32 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.29 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.28 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.2 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.2 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.19 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.17 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.15 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.15 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 97.13 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.13 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 97.12 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 97.09 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.07 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.06 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 97.05 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.03 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.02 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.0 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.98 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.98 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.96 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.96 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.95 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.94 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.92 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 96.86 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 96.82 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.82 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.77 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.77 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 96.76 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.73 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.69 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.69 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.69 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 96.67 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.63 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.54 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.53 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.51 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.48 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.39 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.37 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 96.36 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.35 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.27 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.27 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.25 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.24 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 96.24 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.23 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.21 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.15 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 96.09 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 95.99 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 95.99 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 95.99 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.97 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 95.97 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 95.97 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.94 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 95.9 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.87 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 95.87 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.86 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.84 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 95.83 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 95.7 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 95.45 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 95.41 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 95.4 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 95.34 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.32 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.32 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 95.29 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 95.27 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.27 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.22 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 95.22 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 95.17 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 95.13 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.12 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.02 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 94.98 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.98 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 94.95 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 94.94 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.9 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 94.89 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 94.85 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.84 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.83 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 94.82 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.79 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 94.77 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 94.76 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 94.74 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.73 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.73 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.68 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.67 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.62 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 94.51 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.49 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 94.46 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.42 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 94.42 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 94.41 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 94.38 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.37 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 94.37 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 94.35 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 94.3 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 94.3 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 94.28 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 94.26 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.26 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 94.25 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.22 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.19 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.17 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.16 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 94.14 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 94.14 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 94.11 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.09 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 94.08 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 94.07 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 94.05 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 93.98 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 93.96 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 93.95 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 93.94 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 93.94 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 93.91 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 93.89 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 93.88 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 93.84 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 93.84 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 93.8 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 93.78 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.74 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 93.73 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 93.72 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 93.72 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.71 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 93.68 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 93.65 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 93.64 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 93.59 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.42 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 93.41 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 93.4 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 93.37 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.37 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 93.35 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 93.3 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.14 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 93.1 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 92.95 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.92 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 92.91 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 92.84 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.76 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.51 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 92.45 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.37 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.21 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 92.15 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 92.13 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 92.08 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 91.94 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.89 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 91.71 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 91.69 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 91.67 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 91.55 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.53 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 91.45 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.45 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.38 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 91.26 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 90.91 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 90.87 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 90.81 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 90.8 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 90.54 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 90.28 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 89.44 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 88.67 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 87.9 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.81 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 87.35 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 87.27 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 87.06 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 87.04 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 86.91 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 85.98 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 85.93 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 85.85 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 84.47 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 84.45 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 84.29 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 83.63 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 83.14 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 81.99 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 81.95 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 81.54 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 81.49 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 81.38 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 80.93 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 80.47 |
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: Transcriptional regulator NadR, ribosylnicotinamide kinase domain species: Haemophilus influenzae [TaxId: 727]
Probab=98.49 E-value=1.8e-08 Score=67.28 Aligned_cols=40 Identities=5% Similarity=-0.304 Sum_probs=34.8
Q ss_pred eeeeccCCCchhHHHHHHhcCCCceEeeccceeeeccCCce
Q psy7554 25 YLSCLPDSVCPHAHQVDLTDGPDLFCRTYQVYLMVYKGLDV 65 (115)
Q Consensus 25 ~li~GpTasGKS~lai~LA~~~~~eI~IsaDSmQVYkgldI 65 (115)
|+|+||+|||||+||..||+.++... ++.|...+......
T Consensus 10 I~i~G~~GsGKTTla~~La~~~~~~~-i~~~~~~~~~~~~~ 49 (192)
T d1lw7a2 10 VAILGGESSGKSVLVNKLAAVFNTTS-AWEYGREFVFEKLG 49 (192)
T ss_dssp EEEECCTTSHHHHHHHHHHHHTTCEE-ECCTTHHHHHHSSS
T ss_pred EEEECCCCCCHHHHHHHHHHHhCCCe-EeeehHHHhhhhcc
Confidence 67899999999999999999999999 99888876665443
|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|