Diaphorina citri psyllid: psy755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MGSHMARNLLKNGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVK
ccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccHHHHHccccEEEEEcccccHHHHHHccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccHHHHHcccEEEECcccHHHHHHHHHHHHHHcccCEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccc
MGSHMARNLLKNGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSHMARNLLKNGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-hydroxy-3-oxopropionate reductase confidentP0ABQ3
Probable 3-hydroxyisobutyrate dehydrogenase confidentP63935
Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial confidentQ9XTI0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043718 [MF]2-hydroxymethylglutarate dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042838 [BP]D-glucarate catabolic processprobableGO:0019752, GO:0044248, GO:0019394, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0071704, GO:0044238, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0044723, GO:0009056, GO:0019392, GO:0044724, GO:0043649, GO:0043648, GO:0005975, GO:0006082, GO:0046395, GO:0016054, GO:0016052, GO:0044237, GO:0019577, GO:0043436, GO:0019579, GO:0042836
GO:0051187 [BP]cofactor catabolic processprobableGO:0051186, GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OBB, chain A
Confidence level:very confident
Coverage over the Query: 2-183
View the alignment between query and template
View the model in PyMOL